KEGG   Pseudomonas mandelii: OU5_1631Help
Entry
OU5_1631          CDS       T03626                                 

Definition
(GenBank) glutathione S-transferase-like
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
pman  Pseudomonas mandelii
Brite
KEGG Orthology (KO) [BR:pman00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OU5_1631
Enzymes [BR:pman01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     OU5_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_6 CcmH
Motif
Other DBs
NCBI-ProteinID: AHZ68710
UniProt: A0A024E819
LinkDB All DBs
Position
complement(1872105..1872749)
Genome map
AA seq 214 aa AA seqDB search
MQLFSLPTPNGVKVGIMLEETGLEYEAHRVDIMADESHDPAFLALNPNGKIPAIYDPDGP
SGKPLALFESGAILLYLADKTGQFISADPNTRFETIQWLMWQMGGVGPMFGQVGFFNKFS
GKDYEDKRPRDRYVTESARLLNVLDDRLAHRDWVMGDDYSIADISLLGWVRNLIGFYEAR
ELVGFDRFLHVQAWFNRSLERPAVQRGLVVTATN
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttgcaactcttttcgctgccgacgcccaatggggtgaaggtcggcatcatgcttgaggaa
actggtctcgagtacgaggcgcatcgagtcgacatcatggcagacgaaagccatgaccca
gcctttctcgcgctcaaccccaatggcaagattcccgcaatttacgaccccgatgggccg
agcggtaagccgcttgcgctgttcgaatcgggcgcgatcctgctctatcttgccgacaag
acggggcagtttatttcggccgatccgaacacccgcttcgaaactatccagtggctgatg
tggcagatggggggcgttgggccgatgttcggccaagtcggattctttaacaagttctct
ggcaaagactatgaggacaaacgtcctcgcgaccgctacgtaaccgaatcagcgcggctg
ctcaacgtccttgacgatcggcttgcgcaccgcgactgggtgatgggggatgactacagc
atcgccgatatttcgttgcttggttgggtgcgtaatctgatcggtttttatgaagcgcgc
gagctcgtcggcttcgaccgttttcttcatgttcaagcatggttcaaccgtagcctcgag
cgtccagcggtgcaacgcgggctcgtagtgacagcaactaattga

DBGET integrated database retrieval system