KEGG   Pseudomonas mandelii: OU5_2026Help
Entry
OU5_2026          CDS       T03626                                 

Gene name
ung
Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
pman  Pseudomonas mandelii
Pathway
pman03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pman00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    OU5_2026 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pman03400]
    OU5_2026 (ung)
Enzymes [BR:pman01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     OU5_2026 (ung)
DNA repair and recombination proteins [BR:pman03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     OU5_2026 (ung)
 Prokaryotic type
     OU5_2026 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AHZ69105
UniProt: A0A024E946
LinkDB All DBs
Position
complement(2306119..2306832)
Genome map
AA seq 237 aa AA seqDB search
MFLPDVTMTADDRIKLEPGWKEALRAEFDQPYMAELRNFLQQERAAGKEIYPPGPMIFNA
LNSTPLDKVKVVILGQDPYHGPGQAHGLCFSVQPGVPAPPSLVNIYKELKRDLNIDIPNH
GYLQSWADQGVLMLNTTMTVERANANAHKDKGWQFFTDRIIEVVSQQQPHLVFMLWGAHA
QSKQKLIDATKHLVLTSVHPSPLSAYRGFLGCGHFSRTNKFLEQNGETPIEWRLPPV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttgccggatgtaaccatgactgctgatgaccgtatcaaactcgaaccgggctgg
aaggaggcactacgtgccgaattcgaccagccctacatggcagagttgcgtaatttcctg
cagcaggagcgcgcggcgggcaaggagatttatcctccgggcccaatgattttcaacgcc
cttaactccacgccgctggacaaggtcaaggtcgtcatcctcggtcaggacccgtatcac
ggcccgggacaggcccacgggctgtgcttctcggtgcaaccgggtgtgccggcgccaccg
tcgctggtaaacatctataaagagctgaaacgcgacctgaacatcgacatccccaaccac
ggctatctgcagagctgggctgatcaaggcgtgttgatgctcaacaccaccatgacggtc
gagcgcgccaacgccaatgcgcacaaggacaagggctggcagtttttcacggatcgaatt
attgaagtggtcagtcaacagcaaccacatctggtgttcatgctgtggggcgcgcatgcc
caaagcaaacagaaactcatcgatgccaccaagcacctggtgctgacgtcggtgcacccg
tcaccgctgtccgcttatcgcggttttctggggtgcgggcatttcagccggaccaacaag
tttcttgaacagaatggcgaaacgccgattgagtggcggttgccgccagtctaa

DBGET integrated database retrieval system