KEGG   Pseudomonas mandelii: OU5_3052Help
Entry
OU5_3052          CDS       T03626                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pman  Pseudomonas mandelii
Pathway
pman00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pman01100  Metabolic pathways
pman01110  Biosynthesis of secondary metabolites
pman01130  Biosynthesis of antibiotics
pman01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OU5_3052 (aroK)
Enzymes [BR:pman01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     OU5_3052 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: AHZ70131
UniProt: A0A024EBZ2
LinkDB All DBs
Position
complement(3466112..3466603)
Genome map
AA seq 163 aa AA seqDB search
MGAGKSTIGRLLAKELRLPFKDSDKEIELRTGANIPWIFDKEGEPGFRDREQAMIAELCG
CDGVVLATGGGAVMREANRRALHAGGRVVYLHASVEQQVGRTSRDRNRPLLRTADPAKTL
RDLLAIRDPLYREIADLVVETDERPPRMVVLDILERLQQLPPR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgggggctggaaaaagcaccatcggccggttgctggccaaagagctgcgcctgccgttc
aaagattccgataaggaaattgaattgcgcacgggcgccaatatcccgtggattttcgat
aaagaaggcgaaccgggctttcgtgaccgcgagcaggcgatgattgccgagctgtgcggc
tgcgatggcgtggtgttggcgaccggtggcggcgcggtgatgcgcgaagccaatcgtcgg
gcgttgcacgccggcggtcgggtggtctatctgcatgcctctgtcgagcagcaggtcggc
cgcacgtcccgcgatcgcaatcgccccttgttgcgcaccgctgatccggccaagaccctg
cgggatctgctggcgatccgcgacccgctgtatcgggaaatcgctgacctggtggttgaa
accgatgagcggccgccgcgaatggtcgtgctcgatattctcgaacgcttgcagcaacta
cctccccgttaa

DBGET integrated database retrieval system