KEGG   Pseudomonas mandelii: OU5_4528Help
Entry
OU5_4528          CDS       T03626                                 

Definition
(GenBank) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pman  Pseudomonas mandelii
Pathway
pman00550  Peptidoglycan biosynthesis
pman01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pman00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OU5_4528
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    OU5_4528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pman01011]
    OU5_4528
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pman03036]
    OU5_4528
Enzymes [BR:pman01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     OU5_4528
Peptidoglycan biosynthesis and degradation proteins [BR:pman01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   OU5_4528
Chromosome and associated proteins [BR:pman03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    OU5_4528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHZ71607
UniProt: A0A024EFM5
LinkDB All DBs
Position
5048743..5050485
Genome map
AA seq 580 aa AA seqDB search
MMKLEGALFPWRFRLVLGLLGIMVAAICWRIIDLQVVDRAFLKGQGDARSVRHIPIPAHR
GLITDRNGEPLAVSTPVTTLWANAKEMQLAKEKWPALAAALGQDPKALAERLEAQANKEF
IYLVRGLTPEQGQSVLDLKVPGVYGIEEFRRFYPAGEVTAHMVGFTDIDDHGREGVELAY
DEWLAGVPGKRQVIKDRRGRLIKDVQVTKNAKAGKPLALSIDLRLQYLANRELRNAIIEN
GAKAGSLVIMDVKTGEILAMVNQPTYNPNNRRNLQPAMMRNRAMIDVFEPGSTMKAISMS
AAIETGRWKPSDTVEVYPGTLQIGKYTIKDVSKSEGPVLDLTGILINSSNVGMSKVAFDI
GGETIFRLAQKVGLGQDTGLGFPGERVGNLPNYREWRKAETATLSYGYGISVTAIQLVHA
FSALANNGRLAPLTLIKTDKPAQTTQVLPEAVAKTMQTMLTQVIEAPRGVFRAQVPAYHV
GGKSGTARKTSVGTKGYAENSYRSLFAGFGPMSDPRYAIVVVIDEPTKAGYYGGLVSAPV
FSKVMSGTLRLMNITPDNLPPTQTANATPVVPLKANGGRG
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactcgaaggcgcactgttcccatggcgtttccgcctggtgctgggcttgctc
ggcatcatggtcgcggcgatttgctggcgcatcatcgacctgcaagtcgtcgaccgtgcc
ttccttaaaggtcagggcgatgcgcgcagcgttcgtcacattccgattccggctcaccgt
ggtctgatcaccgaccgtaacggcgagccattggccgtgagtaccccggtcaccacactg
tgggcgaacgccaaggaaatgcagctggccaaagagaaatggccagccctggcggccgcg
ctgggccaagaccctaaagccctggccgaacgtctcgaagcccaggccaacaaagaattc
atctacctggtgcgcgggctgactcccgagcaaggccagtccgtgctcgacctgaaagtg
ccgggtgtctacggcatcgaagagttccggcgtttctacccggccggtgaagtcaccgca
cacatggtcggctttaccgacatcgatgaccacggtcgtgaaggggtcgaactggcctac
gacgaatggctggccggcgtccccggcaagcgacaggtcatcaaggatcggcgtggccga
cttatcaaggatgtccaggtcaccaaaaacgccaaggccggcaagcccttggcgttgtcc
attgacctgcgtctgcaatacctggccaaccgcgagctgcgtaacgcgatcatcgagaac
ggtgccaaggccggcagcctggtgatcatggacgtgaagaccggtgagatcctcgccatg
gtcaaccagccgacctacaacccgaacaaccgtcgcaacctgcaaccggcgatgatgcgc
aaccgcgccatgatcgacgtgttcgagccgggttcgaccatgaaagccatttccatgagt
gccgcgatcgaaaccgggcgctggaaaccgagcgacaccgtcgaggtgtacccgggcact
ttgcagattggtaaatacaccatcaaggacgtctccaagtccgaaggcccggtgcttgac
ctgaccggcatcctgatcaattccagtaacgtcggcatgagtaaggtcgcgttcgatatc
ggcggcgaaaccatcttccgcctcgcgcagaaagtcggcctcggccaagacaccggtctc
ggcttcccgggcgaacgcgtcggaaacctgccgaactaccgcgaatggcgcaaggctgaa
accgccacgctgtcctacggctacggtatttccgtgaccgcgatccagctggtccacgcc
ttctcggccctggccaacaacggtcgtctcgcaccgctgaccctgatcaaaaccgacaaa
ccagcgcaaaccacgcaagtgctgccggaagccgtcgcgaaaaccatgcagaccatgctg
acccaggtgatcgaagccccgcgcggtgtattccgtgcgcaagtgccggcgtatcacgtg
ggcggcaagtcgggtactgcgcgcaagacgtcggtgggcaccaaaggctacgccgagaat
tcctaccgatcgctgttcgccggcttcggcccgatgagcgatccgcgctatgcaatcgtg
gtggtgatcgatgaaccgaccaaagccggttactacggtggtctggtatcggccccggtg
ttcagcaaagtgatgtccgggacgctgcgcctgatgaacatcaccccggacaacctgcca
ccgacgcaaaccgctaacgccacaccggtcgttccactgaaagccaatggagggcgcggc
taa

DBGET integrated database retrieval system