KEGG   Planococcus maritimus: B0X71_00560Help
Entry
B0X71_00560       CDS       T04763                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pmar  Planococcus maritimus
Brite
KEGG Orthology (KO) [BR:pmar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pmar03012]
    B0X71_00560
   03029 Mitochondrial biogenesis [BR:pmar03029]
    B0X71_00560
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmar04147]
    B0X71_00560
Translation factors [BR:pmar03012]
 Eukaryotic Type
  Elongation factors
   B0X71_00560
 Prokaryotic Type
   B0X71_00560
Mitochondrial biogenesis [BR:pmar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B0X71_00560
Exosome [BR:pmar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B0X71_00560
  Exosomal proteins of breast cancer cells
   B0X71_00560
  Exosomal proteins of colorectal cancer cells
   B0X71_00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Transglut_core
Motif
Other DBs
NCBI-ProteinID: AQQ51761
UniProt: A0A1Q2KUA0
LinkDB All DBs
Position
113001..114188
Genome map
AA seq 395 aa AA seqDB search
MGKAKFDRSKTHANIGTIGHVDHGKTTLTAAIATVLARASGGEARSYDQIDNAPEEKERG
ITINTSHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKALE
GETEWEEKILELMNAVDEYIPTPERDTDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
ENVQIIGLTEEPKTTTVTGVEMFRKLLDYAEAGDNIGALLRGVSRDDIQRGQVLAKPGTI
TPHTEFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGVITLPEGVEMVMPGDNIEM
NVALISPIALEDGTKFSIREGGRTVGAGVVAKITK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagctaaatttgaccgctccaaaacacacgcgaatatcggtacaatcggacac
gttgaccatggtaaaactacgctgactgcagcaattgctacagttcttgctagagcatca
ggcggggaagctcgttcttatgaccaaatcgacaacgcacctgaagaaaaagagcgtggt
atcacaatcaacacttctcacgttgagtacgaaactgctactcgccactatgcacacgtt
gactgcccaggtcacgctgactatgttaaaaacatgatcactggtgctgcacaaatggat
ggcgggatcctggtagtatctgctgctgatggcccaatgccacagactcgtgagcacatc
cttctttcacgtcaggtaggcgtaccttaccttgttgtattcttgaacaaatgcgacatg
gtagacgacgaagagcttcttgaactcgttgaaatggaagttcgcgacctgttgtctgaa
tatgacttccctggcgacgatgtacctgttgttaaaggttccgctctgaaagctctcgaa
ggcgaaactgaatgggaagaaaaaatcttggaactgatgaatgcagttgatgagtacatc
ccaactccagaacgcgacactgacaagccattcatgatgccggttgaggacgtattctca
atcactggccgtggtacggttgcaactggacgtgtagaacgcggacagatcaaggttggc
gaaaacgttcaaatcatcggtcttactgaagaaccaaaaactacaactgtaacaggtgta
gaaatgttccgtaagcttcttgactacgcagaagctggcgacaacattggcgcacttctt
cgcggtgtttcccgtgatgacattcagcgtggacaggttctggcgaagccaggcacaatc
actccacatactgaattcaaagcggaagtttatgtgctttcaaaagaagaaggtggacgt
catacgccattcttctcaaactatcgtccgcagttctacttccgtacaactgacgtaacg
ggcgttatcactcttcctgaaggcgttgaaatggttatgcctggggacaacatcgaaatg
aacgttgccctgatctctccaatcgcgcttgaagatggaacgaaattctcaatccgtgaa
ggtggccgtactgtaggcgccggcgtcgttgctaaaatcacgaagtaa

DBGET integrated database retrieval system