KEGG   Planococcus maritimus: B0X71_02290Help
Entry
B0X71_02290       CDS       T04763                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
pmar  Planococcus maritimus
Brite
KEGG Orthology (KO) [BR:pmar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmar02000]
    B0X71_02290
Transporters [BR:pmar02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    B0X71_02290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 SMC_N AAA_29 AAA_16 RsgA_GTPase AAA_23 AAA_22 AAA_28 AAA_30 Gp138_N Zeta_toxin AAA_33 AAA_27 AAA_24 AAA_5
Motif
Other DBs
NCBI-ProteinID: AQQ52064
UniProt: A0A1Q2KVC7
LinkDB All DBs
Position
415983..416744
Genome map
AA seq 253 aa AA seqDB search
MIQVRELSKFYGKKPVIEKVSVNIQRGQITSFIGPNGAGKSTLLSMVSRLIDADTGSVLI
DQTDSKKLKSNEFSKRVSILKQSNYMNVRLTIRELVAFGRFPHSKGRLTAEDEEMIDRSI
DYMNLKDLEDRYLDELSGGQRQRAFVAMVIAQDTEYILLDEPLNNLDMKHSVQIMKILRR
LVDELGKTVVIVLHDINFASVYSDRIVALKDGQVIKDGPTHEIIQSAALKEIYDMDIPIQ
QMDNCRICVYFNS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagttcgcgaactatcaaagttttacggaaagaaaccggtcatcgagaaagta
tctgtcaatatccagcgcggtcagattacatcgttcatcggaccgaacggagcagggaaa
tcaacactcctgtcaatggtcagccggctgatcgatgccgatacgggaagcgtgctgatt
gaccagaccgattcgaaaaaactgaaatccaatgagttttcgaaacgtgtttcaattctc
aagcagtcaaattacatgaatgtaaggcttacgatccgggaattggttgctttcggccgc
tttccgcattcaaagggcaggctgacggcagaagacgaagagatgatcgaccggtccatt
gattacatgaatttgaaagacctggaagaccggtatttggatgagttgtccggcgggcag
cgccagcgtgcatttgtcgccatggtgatcgcccaggatacagaatacattctgctcgat
gaaccgttgaataacctggacatgaagcattcggtccagattatgaaaatcctccgccgg
ctggtggatgagcttggcaagacagtagtcattgtcctgcatgatatcaattttgcttcc
gtctattccgatcgcattgttgcattaaaggacggccaggtcatcaaggatggcccgacg
catgaaatcattcaatcggccgcattgaaagaaatttatgacatggatattccgattcag
cagatggataattgccggatctgtgtttactttaactcgtga

DBGET integrated database retrieval system