KEGG   Planococcus maritimus: B0X71_02670Help
Entry
B0X71_02670       CDS       T04763                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pmar  Planococcus maritimus
Pathway
pmar00473  D-Alanine metabolism
pmar00550  Peptidoglycan biosynthesis
pmar01100  Metabolic pathways
pmar01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pmar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B0X71_02670
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B0X71_02670
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    B0X71_02670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmar01011]
    B0X71_02670
Enzymes [BR:pmar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B0X71_02670
Peptidoglycan biosynthesis and degradation proteins [BR:pmar01011]
 Precursor biosynthesis
  Amino acid ligase
   B0X71_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AQQ52134
UniProt: A0A1Q2KVJ3
LinkDB All DBs
Position
494165..495235
Genome map
AA seq 356 aa AA seqDB search
MKKRIGLLYGGKSAEHEVSLATALAVSKALNYKEYDVYPVYITSEGEWKRGPLLEGPADN
TAQLQLGDGPGQANDISEFLPTEADGQLDVIVPLLHGPNGEDGTVQGLLEVLNLPYVGNG
VLASAAGMDKVIMKQLFSVAGLKQTPYVYFLRSDWQKNREQLLDQVETELTWPVFVKPAN
LGSSVGISKAQNRDELNAAVLEALKFDRKVIVEQGVNGREIEIAVLGNDEPECSVAGEIK
PLKGFYDYEAKYKDGDTALVVPAELDNAVYEQLADQAKRAFKILDCSGLVRADFFVTEEN
DVLINEVNTMPGFTPYSMFPLMWQQSGLSYPDLIEQLINLAIERHREKQQLQSKRD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgaattggattgctctatggcggcaagtctgcagaacatgaagtctcgctc
gctacggcgcttgctgtttcaaaagctcttaattataaagaatacgatgtatatcctgtt
tacataacaagtgaaggtgagtggaaacggggcccgctgctcgaagggccggctgacaat
acggctcaattgcagcttggcgatgggccgggccaggcaaatgacatctctgaatttctg
ccgactgaggcggatgggcagcttgatgtgattgttccgctgcttcacgggccaaatgga
gaagacgggacggtccagggcctgctcgaagtgctgaacctgccgtatgttggcaatggc
gtgctggcatccgctgccggtatggataaagtgatcatgaagcagctgttttctgtggca
ggcctgaagcagaccccttatgtatactttcttcgcagcgattggcagaaaaaccgggag
cagctgcttgatcaggtggaaaccgaattgacgtggccggtatttgttaaaccggcgaat
ctcggatcgagcgtcggcatcagcaaagcgcagaatcgggatgagctgaatgccgctgtc
ctggaggcactgaagtttgacaggaaagtaattgtggaacagggagttaatgggcgtgaa
attgagatcgctgtattgggcaacgatgagccggaatgctcggtggccggagagataaag
ccgctgaaggggttctatgattatgaagccaagtacaaagatggcgacacagccctggtc
gtgcctgcagagctggacaatgcagtctatgagcagctggcagatcaggcaaaacgggca
tttaagattctggattgctccggacttgtgcgtgccgatttctttgtcactgaagaaaat
gatgtgcttatcaatgaagtgaacacaatgccgggctttacaccatatagcatgttcccg
ctcatgtggcagcagtccggcctgtcatatccggatcttatcgaacagctgatcaacctg
gcgatcgagaggcaccgggaaaaacagcagctgcaatccaaaagggattaa

DBGET integrated database retrieval system