KEGG   Planococcus maritimus: B0X71_15930Help
Entry
B0X71_15930       CDS       T04763                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
pmar  Planococcus maritimus
Brite
KEGG Orthology (KO) [BR:pmar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pmar02022]
    B0X71_15930
Two-component system [BR:pmar02022]
 OmpR family
  Unclassified
   B0X71_15930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: AQQ54442
UniProt: A0A1Q2L3I7
LinkDB All DBs
Position
complement(3135290..3135973)
Genome map
AA seq 227 aa AA seqDB search
MRILAVEDDPGVRSMLELFFSKEGIAGEFAEDGLAGYEAFKQDDFDLLILDWMLPGMDGM
ALCRKIREEGSNVPIIMLTAKDSESDQVIGFEMGADDYVTKPFSPLALMARIRAVARRSR
QPEASDEIRTAYFRVNMETREVIADGKPIDNLTPKEFDLLVYFLQHPRQVFSREQLLERV
WGYEFYGDERTVDVHIKRLRKKIPAGESLIHTVWGVGYKLEERQDAH
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatattagcagtggaagatgatcccggagtccgttcgatgctggagctttttttc
tcgaaggaaggcatcgccggagaatttgcggaagacggactggccggttatgaagcgttt
aagcaggatgattttgacctgctcatactggattggatgctgccgggaatggatggaatg
gcattgtgccgcaaaatccgggaagaaggcagcaacgtcccgatcattatgctgacagca
aaggacagcgaatcggatcaggtgatcgggtttgagatgggcgcggatgattatgtaacg
aagccgttcagcccactggcgctcatggcgcgcatccgggcggtcgcccgccggtcgagg
cagccggaagcatccgatgaaatccggaccgcttatttccgggtaaatatggaaacccgt
gaagtgatcgctgacgggaagcccattgacaatctgacaccaaaggaattcgatttgctg
gtgtatttcctccagcatccaaggcaggtattcagccgggagcaattgctggaacgggta
tggggatatgagttttatggcgatgaacggacagttgacgtgcacatcaagcggctgcgg
aagaaaattccggccggtgaatccctgatccatacggtgtggggtgtgggttataagctt
gaggagcggcaggatgcgcattaa

DBGET integrated database retrieval system