KEGG   Prochlorococcus marinus AS9601: A9601_04551
Entry
A9601_04551       CDS       T00464                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb00010  Glycolysis / Gluconeogenesis
pmb00020  Citrate cycle (TCA cycle)
pmb00620  Pyruvate metabolism
pmb01100  Metabolic pathways
pmb01110  Biosynthesis of secondary metabolites
pmb01120  Microbial metabolism in diverse environments
pmb01200  Carbon metabolism
Module
pmb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9601_04551 (pdhC)
   00020 Citrate cycle (TCA cycle)
    A9601_04551 (pdhC)
   00620 Pyruvate metabolism
    A9601_04551 (pdhC)
Enzymes [BR:pmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A9601_04551 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Other DBs
NCBI-ProteinID: ABM69743
CYORF: A9601_04551
UniProt: A2BPN2
LinkDB
Position
394884..396251
AA seq 455 aa
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVARGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENEDEIASVQEQNKGNQPEVSSSDQLELVSNKTEEKPLVQTEI
VEKQEKEVVLMSEKAAPSSNSDQINAATSNVSSRVIASPRAKKLASQMGVDLAKVHGSGP
HGRIQADDILKANGQPVSIPWIGEGGSPASIPGVNLGVESKPEASGNSFGNPGETVQFNT
LQKAVNKNMESSLDVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRSKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANSDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLASLIQDEPETLVS
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtctcacgaaatattcatgcctgccttgagttctaccatgacggagggcaagattgtg
gaatggttgaaaaatccaggagataaagttgcaagaggtgaatctgtcttggttgttgaa
tctgacaaggcagatatggatgttgaatcttttcaagatggataccttgcagctgtttta
atgcctgctggcagcactgcaccagtaggagagactatcggtttaattgtagaaaatgag
gatgagatagcttctgttcaagaacaaaataaaggaaatcaacccgaagtttctagttcg
gatcaacttgaattggtaagcaataaaactgaagaaaaacctttggttcaaactgaaatt
gttgaaaaacaagaaaaagaagttgtattaatgagtgaaaaggcagccccatcttctaat
agtgatcaaataaatgctgctacgagtaatgtttcttcgagggtgattgcatctccaaga
gctaaaaaacttgcctctcaaatgggtgttgatttagcaaaggttcatggatcaggacct
catggaaggattcaagccgatgatattttaaaagctaatggccaaccagtctctatacca
tggataggcgaaggtggttctcctgcaagtatccctggtgtaaatttgggggttgaaagt
aaaccagaagcttcaggaaatagttttggtaatcccggagaaacagttcaatttaatact
cttcaaaaagcggtaaataaaaatatggaatctagtttagatgtgccatgttttagagtg
ggttactccatcaacacagataaattagataatttttataaaaaagtaaaacagaatgga
gtgactatgactgctttactagttaaagcagttgctaagacactaaagaaacaccctcaa
gttaactcaagtttttcagaaaatggaatttcttatccagaaaatataaatattgctgtt
gctgtagcgatggaagatggtggactaataactccagttttaaaagaaccatgcaatact
gatttatttgaattgtctagggaatggaaagatctcgtaaaaagatcaagatcaaaacaa
ttagaacccgatgaatactcaacgggaaccttcactttatctaaccttgggatgtttgga
gttgatagatttgacgcaattcttcctccaggtaccggtgctattttagccatagcatca
tcgaaaccaaccgttgttgctaatagtgatggttcaatatctgttaaaaaaataatgcaa
gtaaatctaacggctgatcatagagtgatctatggagctgatggagcttcattcttaaaa
gacttggcttccctaattcaagatgagccagagactcttgtctcctaa

DBGET integrated database retrieval system