KEGG   Prochlorococcus marinus AS9601: A9601_06221Help
Entry
A9601_06221       CDS       T00464                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pmb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A9601_06221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmb02000]
    A9601_06221
Enzymes [BR:pmb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A9601_06221
Transporters [BR:pmb02000]
 Other Transporters
  Pores ion channels [TC:1]
   A9601_06221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N_4 GST_N Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ABM69908
CYORF: A9601_06221
UniProt: A2BQ47
LinkDB All DBs
Position
complement(543162..544397)
Genome map
AA seq 411 aa AA seqDB search
MNGILTWDDLNKFEVEDLDRVNGINNSYANLRLFGHSENDVLVTLYRDRHSWCPYCQKIW
LWLEFKKIPYRVKKINMFCYGQKESWFLEKVRSGKLPAIEFKEQVITESDDIIAFLENEF
GALGSFITSSHLIKIRELEREIFRSWCDWLCRESFNFIDNSFRKKRFKESISKLDEILSS
SKSGFVDPSVSNTGDLEPGVGDIIFIPYMERMNASLIYYKGFNLRSNYRHVDNWLTLFEG
TSAYRGTQGDFHTHSHDLPPQMGGCYKESNEQQITFSKLIDTGEGLGNYELNQNYESKYY
ATIALKRVIKHKDNLLKVNPYNKESFDESLRSALSHMITGEVLIPKKLSGISLRYLKNRI
SVPRDMPIISARLLRQSLNKIESLSNINEIDKIPFRHRYDQDPINFISSYK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggattttgacatgggatgatttaaataaatttgaagtcgaagatcttgataga
gtcaatggtataaataattcctacgcaaatttaagattatttgggcatagtgaaaatgat
gtattagttaccctttatagggataggcattcttggtgtccttactgtcagaagatatgg
ttatggcttgaatttaagaaaattccatacagagtcaagaaaataaatatgttttgctac
ggccaaaaagaaagttggttccttgaaaaagtcagatcggggaaattacctgcaattgaa
tttaaagagcaagttatcactgaaagcgacgatatcatagcttttttagaaaatgaattt
ggagcacttggatcttttataacatctagtcacctcatcaaaattcgagagttagaaaga
gaaattttcagatcctggtgtgattggctctgccgagaaagctttaattttatagataac
tcttttagaaaaaaaagatttaaagaatccatttctaaactcgatgaaatcttaagtagc
tcaaaatcagggtttgttgatccatcagtttctaacacgggtgatttagagcctggtgtt
ggagatataatttttattccctatatggagagaatgaatgcatcacttatttattacaaa
gggtttaatttaagatctaattatcgtcatgtagataactggcttaccctttttgagggg
acaagtgcttatagaggcactcaaggagattttcatactcattctcatgatttacctcca
caaatgggaggatgctataaagaaagcaatgaacaacagattactttctctaaactaata
gatactggggagggtttaggtaattatgaattaaaccaaaattatgagtcaaaatattat
gcaacaattgctcttaaaagagtgataaagcataaagacaatttactaaaggtaaatcca
tacaataaagaatcctttgacgaatcattgagatcagctttgagccatatgatcacaggt
gaagtattaatccctaaaaaactttcaggaatctctctaagatacttaaaaaacagaatc
tcagttccaagagatatgccaattatttcagcaaggttattaaggcaatcattaaataaa
attgaatcgcttagtaacatcaatgaaatagataagataccttttaggcatcgatatgat
caagatccaataaatttcatttctagttataagtaa

DBGET integrated database retrieval system