KEGG   Prochlorococcus marinus AS9601: A9601_17821Help
Entry
A9601_17821       CDS       T00464                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmb  Prochlorococcus marinus AS9601
Pathway
pmb00620  Pyruvate metabolism
pmb00680  Methane metabolism
pmb00710  Carbon fixation in photosynthetic organisms
pmb01100  Metabolic pathways
pmb01120  Microbial metabolism in diverse environments
pmb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9601_17821 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A9601_17821 (ppc)
   00680 Methane metabolism
    A9601_17821 (ppc)
Enzymes [BR:pmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A9601_17821 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABM71065
CYORF: A9601_17821
UniProt: A2BTF4
LinkDB All DBs
Position
complement(1513603..1516572)
Genome map
AA seq 989 aa AA seqDB search
MESFRQVKNNNVDLISNNDPLDKNRLLIEDLWESVLREECPDDQAERLIQLKELSYSKQI
DGDSSKTFKNEIVDIVNSMDLAESIAAARAFSLYFQLVNILEQRVEEDRYIQSFTNKDVQ
KSPDNLDPFAPALARQNAPVTFRELFYRLRKLNVPPGKLEELLQEMDIRLVFTAHPTEIV
RHTIRHKQTRVANLLKKIQIEQFLTKEEKNSLKTQLKEEVRLWWRTDELHQFKPSVLDEV
DYALHYFQQVLFNAMPQLRGRIAEALTDNYPDVQLPSESFCNFGSWVGSDRDGNPSVTPE
ITWRTACYQRQLMLERYIIATSNLRDQLSVSMQWSQVSSSLLESLETDRVKFPEIYEARA
TRYRSEPYRLKLSYILEKLRLTQERNNLLADSGWKFDLEGETDNKNLDKVESLYYKSVKE
FTYDLELIKNSLISTDLNCESVNTLLTQVHIFGFSLASLDIRQESTRHSDAIQELTNYLD
LSVQYDQMSEEEKIKWLIDELNTKRPLIPSDVHWTKTTEETFSVFKMVKRLQQEFGSRIC
HSYVISMSHSASDLLEVLLLAKEMGLLDQNSQKSKLLVVPLFETVEDLKRAPEVMEKLFK
LDFYRSLLPKVGESFKPLQELMLGYSDSNKDSGFVSSNWEIHRAQIALQNLSSRNNILLR
LFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELALYNLETVTT
AVIQNSLVNNRLDATPEWNQLMSRLAETSRSHYRKLVHENPDLLNFFQEVTPIEEISKLQ
ISSRPARRKKGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALSSELNLDPQQIELLRV
LHQRWPFFRMLISKVEMTLSKVDLEVARYYVDTLGSKENKDSFDNIFEVISKEYNLTKSL
ILEITGKNKLLESDRDLKSSVSLRNKTIIPLGFLQVSLLRRLRDQTRQPPISEFFLDKDE
STRAYSRSELLRGALLTINGIAAGMRNTG
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggaatcttttcgccaggtaaaaaataataatgtggatctgataagtaacaatgatcca
cttgataaaaatcgtcttctaattgaagatctctgggaatctgtgctaagagaagaatgc
ccagatgatcaagcagaaaggttgatacagcttaaagaattaagttattcaaaacaaatt
gatggcgatagttcaaaaacttttaaaaatgaaatagttgatattgtaaattctatggat
ttagcagaatccatagctgcagcaagggctttttcattatattttcaacttgtgaatatt
ttggaacaaagagttgaggaagatagatatattcaaagctttaccaataaggatgttcaa
aaatcgcccgacaatcttgatccttttgccccagcattggctaggcaaaatgctcctgta
acttttagagaattgttttacaggcttaggaaactaaatgtgccaccaggcaaattagaa
gagttattacaggaaatggatattcgtttagtttttactgcacatccgacggagatagta
agacatacgattagacataagcagacaagagtagcaaatttgttaaaaaaaatacagatt
gagcaatttctgacaaaagaagaaaaaaattctttaaaaacccaattaaaagaggaagta
agactttggtggaggactgatgaattgcatcaatttaaaccttcagttttagatgaagtt
gattatgccttgcattattttcagcaagttttatttaatgcgatgcctcagttgagggga
aggatcgctgaagcacttaccgataattatccagatgttcagttgccctcagaatctttt
tgcaacttcggttcttgggtaggctctgatagggacggtaatccatcggtcactcctgag
ataacatggagaactgcttgctaccaaaggcagttgatgttggaaagatatattattgcg
acgtctaatcttagagatcaattaagtgtttcgatgcaatggagtcaagtcagttcctcc
ttattagagtcacttgaaactgacagggttaagttccctgaaatatatgaagctagagct
acaaggtatagatcagaaccctacagattaaaattaagttatatcctagagaaattaaga
ttaacacaagaaagaaataatttattagctgatagtggatggaaatttgacttggaagga
gaaactgataacaaaaatttagataaagttgaaagcttatattacaagtcagtaaaagaa
tttacttatgatctagaacttatcaaaaatagtttaattagtacagatttaaattgtgag
tctgtaaacaccttacttactcaagttcatatttttggattttccttagcaagtttagat
attcgtcaagagagtacaaggcatagtgacgctattcaagagcttacaaattatcttgat
ttatctgttcaatatgaccaaatgtctgaggaagagaaaattaaatggcttatagacgaa
ttaaatacaaaaaggcctttaattccatctgacgttcactggacaaaaaccacagaagaa
acattttcagtttttaaaatggttaagagactacagcaagaatttggaagtcgcatttgt
cattcttatgtaatttcaatgagtcatagtgcatctgatttgcttgaagttctcttactg
gcaaaagaaatgggacttcttgatcaaaattcacaaaagtcaaaattattagttgttcct
ctttttgaaactgtggaagaccttaaaagagcaccagaagtaatggaaaagttgtttaaa
ttagatttctatagatcattattgccaaaagtaggagaatcttttaaacctctgcaagaa
ttaatgcttggatattctgatagcaataaagattcggggtttgtttctagtaattgggaa
attcatagagcccaaatagctcttcaaaatctttcaagtaggaataacatattgttaaga
ctgtttcatggaagaggtggttctgtaggtagaggaggaggaccagcctatcaggcaata
ttggctcaaccaagcggtactttaaaagggcgaataaaaataacagaacaaggagaagtt
ttagcttctaaatatagtcttccggaacttgctttatacaatcttgaaactgtaactaca
gcggtaattcaaaatagcttggtaaataatagacttgacgctactccagaatggaatcaa
ttaatgtctaggttggcagaaacatcaaggtctcactaccgaaaattagtgcatgagaat
cctgacttgttgaatttctttcaagaggtcactccaatagaagaaataagtaaattacag
atatccagtaggcctgcaagaagaaaaaaaggtgcaaaagatttatcaagtttacgagct
attccatgggtatttggatggacacaaagtagatttcttttaccaagttggtttggagta
ggtactgcattgtcatctgaattaaatttagatccacaacaaattgaattactaagagtc
ttgcatcaaagatggccattttttaggatgcttatatctaaggtagaaatgacattatct
aaggtggatttagaagtggcaagatattatgttgatactcttggcagtaaagaaaataaa
gattcttttgataatatttttgaagtaatttctaaagaatataatctcacgaaatcttta
atacttgaaattactggtaaaaataagcttcttgaatctgatagagacttgaagtcatct
gtaagcttgagaaataagacaatcattccattggggtttttgcaagtttcacttttaaga
agattaagagaccagacaagacaacccccaataagcgagttttttctggataaagatgaa
tctacaagagcttacagcagaagtgaactattaaggggagcacttttaactattaatggg
atagcagctggtatgagaaatacaggataa

DBGET integrated database retrieval system