KEGG   Prochlorococcus marinus MIT 9515: P9515_04661
Entry
P9515_04661       CDS       T00465                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00010  Glycolysis / Gluconeogenesis
pmc00020  Citrate cycle (TCA cycle)
pmc00620  Pyruvate metabolism
pmc01100  Metabolic pathways
pmc01110  Biosynthesis of secondary metabolites
pmc01120  Microbial metabolism in diverse environments
pmc01200  Carbon metabolism
Module
pmc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9515_04661 (pdhC)
   00020 Citrate cycle (TCA cycle)
    P9515_04661 (pdhC)
   00620 Pyruvate metabolism
    P9515_04661 (pdhC)
Enzymes [BR:pmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P9515_04661 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Other DBs
NCBI-ProteinID: ABM71675
CyanoBase: P9515_04661
CYORF: P9515_04661
UniProt: A2BV64
LinkDB
Position
414289..415656
AA seq 455 aa
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENEDEIASIQEQNKGKQIEVSSDAQLKLPNKKSEIIEEKQKEL
PQINEQQVEIKREKVINTSNEIQFNASTSNNSSRVIASPRAKKLASTMGVELTKVHGSGP
HGRIQAEDVLKANGQPVSIPWIGEGSSPASIGSSHVQAESKSETLGNSFGKPGETVKFNT
LQKAVNNNMESSLNVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRAKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANNDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLSSLIENEPETLVS
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtctcacgaaatatttatgccagctcttagttctactatgactgaaggcaaaattgtt
gaatggttgaaaaatcctggagataaagttgaaagaggagaatctgttttagtcgttgaa
tcagataaagctgatatggatgtggaatcttttcaagacggatatcttgcggcagttctc
atgccagctgggagcactgctccagtaggggaaaccataggacttattgtagaaaatgag
gatgagatagcttctatacaagaacaaaataaaggtaaacagattgaagtatccagtgat
gcccaactcaaattgccaaataaaaaatctgaaataatagaagagaagcaaaaagagctg
cctcaaattaatgagcagcaagtcgagattaaaagggaaaaagtgataaatacttctaat
gaaattcaatttaatgcttctactagtaataattcctcgagagtaatagcatctccaagg
gcaaaaaaacttgcttcaacaatgggagttgaattgacaaaagtgcatggatcaggacct
catggaaggattcaggctgaggatgtattgaaggcaaatgggcaacctgtttctatccca
tggattggagaggggagttctccagctagtattggcagttcccatgttcaagctgaaagt
aagtcagagacattagggaatagttttggtaaacctggagaaactgttaaatttaatact
cttcaaaaagctgttaataacaatatggaatctagtttaaatgttccatgttttagagtt
ggttattcaattaatactgataaattggataatttttataagaaagtaaagcaaaatggt
gttactatgactgcattattagtcaaggccgttgcaaagacacttaaaaaacatccccaa
gttaattcaagcttttcagaaaacggaatttcttatccagaaaatataaatattgctgta
gctgttgctatggaagatggcggattgataactccagtattaaaagaaccttgtaacact
gatttatttgaattatctagagagtggaaagaccttgtgaaaagatctagagcaaaacaa
ttagaacctgatgaatactcaacaggaacatttacgttgtctaatttaggaatgtttggt
gttgatagatttgatgcaatacttccaccaggtacgggtgctattttagccatagcatca
tctaagccaacagtcgttgctaacaatgatggttcaatatctgttaaaaaaataatgcaa
gtaaatttaaccgctgatcatagagtgatttatggtgctgatggtgcttcattcttgaaa
gacttgtcttctctcattgaaaatgagccagagacacttgtttcctga

DBGET integrated database retrieval system