KEGG   Prochlorococcus marinus MIT 9515: P9515_06151Help
Entry
P9515_06151       CDS       T00465                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00630  Glyoxylate and dicarboxylate metabolism
pmc00710  Carbon fixation in photosynthetic organisms
pmc01100  Metabolic pathways
pmc01120  Microbial metabolism in diverse environments
pmc01200  Carbon metabolism
Module
pmc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    P9515_06151 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9515_06151 (rbcS)
Enzymes [BR:pmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     P9515_06151 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABM71824
CyanoBase: P9515_06151
CYORF: P9515_06151
UniProt: A2BVL3
LinkDB All DBs
Position
551111..551452
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQEEIYDQIAYIIAQGWSPVIEHVHPSGSMQTYWS
YWKLPFFGEKDLNLVVSELEACHRAYPDHHVRIIGYDAYTQSQGTAFVVFQGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcacagtaggcgactatcaaacagttgcaaccctggaaacattcggt
ttcttaccaccgatgacccaggaagaaatatacgatcaaattgcatacataattgctcaa
ggctggagtcctgttattgagcatgttcatcctagtggcagtatgcaaacttattggtct
tattggaagctcccattctttggggaaaaagaccttaacttggttgtaagtgaattagag
gcatgtcatagagcataccctgatcaccatgtaagaataatcggatacgatgcttacact
caaagccaaggaacagcttttgtagttttccaaggacgttaa

DBGET integrated database retrieval system