KEGG   Prochlorococcus marinus MIT 9515: P9515_17621Help
Entry
P9515_17621       CDS       T00465                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmc  Prochlorococcus marinus MIT 9515
Pathway
pmc00620  Pyruvate metabolism
pmc00680  Methane metabolism
pmc00710  Carbon fixation in photosynthetic organisms
pmc01100  Metabolic pathways
pmc01120  Microbial metabolism in diverse environments
pmc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P9515_17621 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9515_17621 (ppc)
   00680 Methane metabolism
    P9515_17621 (ppc)
Enzymes [BR:pmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     P9515_17621 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABM72969
CyanoBase: P9515_17621
CYORF: P9515_17621
UniProt: A2BYV8
LinkDB All DBs
Position
complement(1547001..1549970)
Genome map
AA seq 989 aa AA seqDB search
MESMKQLKNHNVDLISNNDPLDKNRLLIEDLWESVLREECPNDQANRLMKLKELSYCNQV
EEDISRTFKNEIVDIVNSMDLAESISAARAFSLYFQLVNILEQRVEEDRYIQSFTNKNNQ
KSHDNLDPFAPALARQNAPVTFRELFYRLRKLNVPPGKLEELLQEMDIRLVFTAHPTEIV
RHTIRHKQTRVANLLQKIQVEKFLTVEDIKSLKIQLKEEIRLWWRTDELHQFKPSVIDEV
DYALHYFQQVLFNAMPQLRGRISSALTENYPDVQMPTESFCTFGSWVGSDRDGNPSVTPE
ITWRTACYQRKLMLERYISATSNLRDQLSVSMQWSQVSSSLLESLETDRVQFPEIYEARA
TRYRSEPYRLKLSYILEKLRLTKERNNLLAEAGWKFSLERESDNKNIELVEKLHYRSVDE
FTYDLELIKNSLNSTDLTCEAVSKLLTQVHIFGFSLASLDIRQESTRHSDAIQELTNYLE
LPKKYDQMPEIERIEWLKDELNTKRPLIPAEVSWTKSTEETFSVFKMVKRLQEEFGSRIC
HSYVISMSHSASDLLEVLLLAKEMGLIDQSSQKSKLLVVPLFETVEDLKRAPEVMEQLFQ
LDFYRSLLPKVGERFKPIQELMLGYSDSNKDSGFLSSNWEIHRAQIALQNLSSKNNILLR
LFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELALYNLETVTT
AVIQNSLVINRLDATPEWNDLMTRLAETSRIQYRKLVHENPNLLTFFQEVTPIEEISKLQ
ISSRPARRKKGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALSVELKSDPEQIELLRV
LHQRWPFFRMLISKVEMTLSKVDLEVAKYYVDTLGSKENAKSFGDIFDVISKEYNLTKSL
VLEITGKNKLLESDRDLRLSVNLRNKTIIPLGFLQVSLLRRLRDQTRQPPISEFLNERNE
SERAYSRSELLRGALLTINGIAAGMRNTG
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggaatctatgaaacaattaaaaaatcataatgtggatctgataagtaataatgatcct
ttagataaaaatcgtttattgatagaggatttgtgggagtctgtattaagggaagaatgc
ccaaatgatcaagcaaatcgcttaatgaagcttaaagaattaagttattgtaatcaagtg
gaagaagatatttccagaacttttaagaacgaaatagttgatattgtgaactccatggat
ttagctgaatcgatttcagccgcaagagctttttcattatatttccagctagttaatatt
ttggaacaaagagttgaggaagatagatatattcaaagctttactaataaaaacaatcaa
aaatcccatgataatctggatcctttcgcacctgctttagctaggcaaaatgctccagta
acatttagggagttattctacaggcttagaaaattaaatgttccaccaggcaaattagag
gaactattgcaagaaatggatattcgcttagtttttacggctcatcctacagagatagtt
agacatacaattaggcataagcaaactagagtagctaatttgcttcaaaaaatacaggtt
gaaaaatttttaaccgttgaagatattaaatcactcaaaatacaattaaaagaagagatt
agattatggtggagaactgatgagttgcatcagttcaaaccatctgtaatagatgaagtt
gattatgctttacattattttcaacaagttctctttaatgcgatgcctcagttaagaggg
agaatttcttcagctcttactgaaaattacccagacgtacagatgccaactgaatctttt
tgtacatttggatcatgggttggttctgatagggatgggaatccatcagttactccagaa
ataacttggaggactgcttgttaccaaagaaaattaatgttggaaagatatattagcgca
acctctaatcttagagatcaattaagtgtttcaatgcaatggagccaagtcagctcatcc
cttcttgaatctttagagacagatagagtgcagtttccggaaatttatgaagcaagggct
acaagatatagatcagagccatatagattgaaattgagttatattttagaaaaattaaga
ttaactaaagaaaggaataatttacttgcagaagccggttggaaattttctttagaacga
gaatcagataataaaaatattgaattagttgaaaaattacattacagatctgttgacgaa
tttacttatgatttggaattaattaaaaatagtcttaatagtactgatttaacatgtgaa
gcagtaagtaaattattaactcaagtacatatttttggtttttctttagcaagtttggat
atacgtcaggagagtactagacatagtgatgcaatacaagaattaactaattatcttgag
ttgcctaaaaaatatgatcaaatgcctgaaatagagagaatagaatggctcaaagatgaa
ttaaatacaaaacggcctttaattccagctgaagttagctggacaaaaagtactgaagaa
actttctcagtttttaaaatggttaaaagattgcaggaagaatttggtagccgtatttgt
cattcatatgtcatttcaatgagtcatagtgcatctgatttgcttgaagtacttctttta
gcaaaggaaatgggacttatcgatcaaagttcccaaaagtcgaaattgcttgttgtccct
ctttttgaaactgttgaggatctgaaaagagctcctgaagtaatggagcaattatttcaa
ttagatttttatagatcattattaccaaaagttggagaaaggtttaaaccgattcaagag
ttaatgttgggttattctgatagtaataaagattcaggtttcttatctagtaattgggaa
atacatagagctcaaattgcccttcaaaatctttcaagcaaaaacaatatacttttaagg
ctatttcatggcagaggaggttcagtaggaagagggggaggtcctgcttatcaagcgata
ttagcccagcctagcggtacgctcaaaggcagaataaaaattacagaacaaggagaagtt
ttagcgtctaaatatagtcttcctgaattggctttatataatttggaaacagtcacaaca
gcagttattcaaaatagcttagtcattaatagacttgatgcaacgccagaatggaacgat
ttaatgactaggttggcagaaacttcgagaattcaatatagaaaattagtgcatgagaat
cctaacttactcactttttttcaagaggtaactcccatcgaagaaattagtaaattgcag
atatccagtagacctgcaagaagaaaaaaaggtgcaaaggatttatcaagtttaagagca
ataccatgggtttttggatggacacagagtagatttcttttgccaagttggtttggagtg
ggtactgcgttatcagttgaattaaaatcagatcctgaacaaattgaattactaagagta
cttcatcaaagatggcctttttttaggatgcttatttctaaagtagaaatgacattatct
aaagttgatctagaagtcgcgaaatattatgtagatacacttggaagtaaagaaaatgca
aagtcatttggtgatatttttgatgttatctctaaagaatataatcttactaaatcttta
gttctcgaaataacaggtaaaaataagcttttggaatctgatagagacttgcgattatct
gtaaacttaagaaataaaacgataattcctttgggatttttgcaggtttcacttttaaga
agactgagagatcaaacaagacaacctccaattagtgagtttttaaatgaaagaaatgaa
tctgaaagagcttatagtcgtagtgaacttttaaggggcgcacttttaacaattaacgga
atcgcggcagggatgagaaatacaggataa

DBGET integrated database retrieval system