KEGG   Prochlorococcus marinus NATL1A: NATL1_04561
Entry
NATL1_04561       CDS       T00467                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00010  Glycolysis / Gluconeogenesis
pme00020  Citrate cycle (TCA cycle)
pme00620  Pyruvate metabolism
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
pme01120  Microbial metabolism in diverse environments
pme01200  Carbon metabolism
Module
pme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NATL1_04561 (pdhC)
   00020 Citrate cycle (TCA cycle)
    NATL1_04561 (pdhC)
   00620 Pyruvate metabolism
    NATL1_04561 (pdhC)
Enzymes [BR:pme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NATL1_04561 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: ABM75020
CyanoBase: NATL1_04561
CYORF: NATL1_04561
UniProt: A2C0L0
LinkDB
Position
417220..418590
AA seq 456 aa
MATHDIFMPALSSTMTEGKIVEWLKKPGDKVERGESVLVVESDKADMDVESFQDGFLASI
VMPAGSSAPVGETIGLIVETEDEIAAAQANSPSPSPQSGSQEKDSSSPQVQEKQASVDSP
KATVVTKASPAPLVSESSVNQDQFLNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQ
AEDVQSAKGQPISVPWIAESNAPAKIVSDVPRVEKKSVDAGKPPAPGKSFGSRGETIAFN
TLQQAVNRNMEESLNTPCFRVGYSILTDELDDLYKQVKPDGVTMTALLAKAVGLTLARHP
QVNAAFSSEGIAYPSQINVAVAVAMEDGGLITPVLQNADKTSLTDLSLQWADLVKRARNK
QLEPQEYSSGTFTLSNLGMFGVDRFDAILPPGTGAILAVGASLSKVVASKDGSISIKKQM
QVNLTADHRVIYGADGALFLKDLAYLIEKNPYSLSS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggccactcatgacatttttatgcctgctttaagttcaacgatgactgagggcaaaata
gttgagtggctaaaaaaacctggagataaagttgaaagaggtgagtcagttttagttgtt
gagtcagataaagctgatatggatgttgagtctttccaagatggctttcttgcttcgatt
gtgatgcctgcaggcagctctgcacctgttggagagacaatcggattgatcgttgagaca
gaagatgagatcgctgcggctcaagcaaattcgccttctccttcccctcaatcaggaagt
caagaaaaagatagttcatcgcctcaagttcaagaaaaacaagcctctgtcgactctcct
aaagcaacagtagttacaaaggcatctcctgcacctcttgtttcagaatcctctgtaaat
caggatcagtttttaaatgatggtcgaatagtcgcttccccaagagctaaaaaacttgct
tctcaaatgggagtggatttggcaactgttaggggctcaggacctcatggacgaatacaa
gctgaggatgttcaaagtgcaaaagggcaacccataagcgttccttggattgcagaaagt
aatgctccggcgaaaatagtttctgatgtgcctcgcgtagaaaaaaaatctgttgacgct
ggtaagccacctgctccagggaaaagttttggatctagaggggaaacaattgcatttaat
actcttcaacaagctgtaaatcggaacatggaggaaagtttaaatactccttgtttcaga
gtcggatattcaattcttactgatgaattggatgatctttataaacaagttaaacctgat
ggagtaactatgactgctttacttgctaaagcagttggcttaacgctggctagacacccc
caggtgaatgcagcttttagttctgaggggattgcctatccttcacaaataaatgtagcc
gttgcagttgcgatggaggacggagggttgataactccagtgctgcaaaatgctgataag
acgagccttactgatttatccctacaatgggctgatcttgttaagcgagctaggaataag
caattagaaccgcaagaatatagcagtggaacgtttacactctcgaatctaggtatgttt
ggagtggatcgttttgatgcaattctgcccccagggactggagcaattttagcggtagga
gcttcattgtctaaagttgttgcttctaaagatggttcgatttcaatcaaaaaacaaatg
caagtaaatcttaccgctgatcacagagtgatatatggggctgatggagcactattcctc
aaggatttggcatacttaattgaaaagaacccttatagcctctcgtcttga

DBGET integrated database retrieval system