KEGG   Prochlorococcus marinus NATL1A: NATL1_05971Help
Entry
NATL1_05971       CDS       T00467                                 

Gene name
chlL
Definition
(GenBank) Protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00860  Porphyrin and chlorophyll metabolism
pme01100  Metabolic pathways
pme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NATL1_05971 (chlL)
Enzymes [BR:pme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     NATL1_05971 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH AAA_31 CbiA ArsA_ATPase ParA AAA_24 SRP54 MeaB MipZ AAA_26 NB-ARC AAA_25 RNA_helicase PRK CBP_BcsQ AAA_16 AAA_22
Motif
Other DBs
NCBI-ProteinID: ABM75159
CyanoBase: NATL1_05971
CYORF: NATL1_05971
UniProt: A2C0Z9
LinkDB All DBs
Structure
PDB: 

Position
complement(542607..543497)
Genome map
AA seq 296 aa AA seqDB search
MTSTITRKEDGEGSVQVKQDPKAQIQEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKV
LQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFMFKGFNGVMCVESGGPPA
GTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFD
SIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNERTGLKTMAHFRNVDAIRR
SRLKKCTIFEMDSEEEGVVEVQNEYLSLAQKMIDNVEPLEAEPLKDREIFDLLGFD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgacaataactcgtaaggaggacggtgaaggtagtgttcaggtaaaacaagac
ccgaaagcacaaattcaggaaggagcactggttattgctgtttatggcaaaggaggtatt
ggtaaatcaactacttcttctaatttgtctgccgcattttcaaagcttggaaagaaagta
cttcaaattggttgtgatccaaagcatgacagcacttttacccttacgcacaaaatggtg
cctaccgtcatagatattcttgaagaagtagattttcatagtgaagaactaagacctgaa
gactttatgtttaaaggtttcaatggggttatgtgcgttgagagtggtggaccaccagcg
ggaactggctgtggtggttatgtcacaggtcaaacggtcaaactattaaaagagcatcat
cttttagaagatactgatgtagttatatttgatgttctaggtgacgttgtatgcggtggc
ttcgcagctccattgcaacacgcaaattattgtctaattgttaccgcaaatgattttgat
tctattttcgcaatgaatcgcatcgtcgcagcaataaacgctaaagcaaaaaattacaaa
gttcgtttaggaggtgtcatagcgaaccgatctgctgaattagatcagatagagaaattc
aatgaaagaacaggtcttaagaccatggctcatttccgtaacgtagatgcaatacgcaga
tcaagactcaaaaagtgcacaattttcgagatggattcggaagaggaaggcgtagtggaa
gtacaaaatgagtatctttcattagcccagaaaatgatagataacgttgagccattagag
gcagaacccttaaaagaccgtgaaatatttgatctattgggctttgattaa

DBGET integrated database retrieval system