KEGG   Prochlorococcus marinus NATL1A: NATL1_20211Help
Entry
NATL1_20211       CDS       T00467                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
pme00620  Pyruvate metabolism
pme00680  Methane metabolism
pme00710  Carbon fixation in photosynthetic organisms
pme01100  Metabolic pathways
pme01120  Microbial metabolism in diverse environments
pme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NATL1_20211 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NATL1_20211 (ppc)
   00680 Methane metabolism
    NATL1_20211 (ppc)
Enzymes [BR:pme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NATL1_20211 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 GAPES4
Motif
Other DBs
NCBI-ProteinID: ABM76577
CyanoBase: NATL1_20211
CYORF: NATL1_20211
UniProt: A2C517
LinkDB All DBs
Position
complement(1663493..1666477)
Genome map
AA seq 994 aa AA seqDB search
MLKNPSNENISNHSTVCVEDQDPGSLLQQRLELVEDLWKTVLKSECPPDQTERLLRLKQL
SDPSKSNQDNSSKAIVQLITKMDLAEAISAARAFSLYFQLVNILEQRIEEDSYLESIEKG
KLDTSNYKIDPFAPALASQTAPATFTQLFERLRRLNVPPAQLDGLMREMDIRLVFTAHPT
EIVRHTVRHKQRRVATLLQQLQSNSLISESEKEIFRLQLEEEIRLWWRTDELHQFKPTVL
DEVDYALHYFQQVLFDAMPQLRRRLTTALASSYPDVEIPNEAFCTFGSWVGSDRDGNPSV
TPEITWRTACYQRQLMLDRYIASVQDLRDQLSISMQWSQVSSPLLESLEMDRVRFPEVYE
ERAARYRLEPYRLKLSYTLERLRLTQLRNKQLADAGWQFSPDGKPQISTNNSFDEVLHYK
SVEELKNELELIRNSLVSTDLTCEPLDTLLNQVHIFGFSLASLDIRQESTRHSDALDELT
RYLDLPESYGVMSEESRVQWLMKELRTRRPLIPPSFEWSKSTQETISVFHMLHRLQKEFG
TRICRSYVISMSHTASDLLEVLLLAKESGLIDPTLGASDLLVVPLFETVEDLQHAPSVME
SLLQSDVYRELLPRVGEKKQPLQELMLGYSDSNKDSGFLSSNWEIHKAQIALQDLASRQG
IALRIFHGRGGSVGRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASKYSLPELALYNLE
TVTTAVIQNSLVTNKLDATPSWNELMTRLAARSREHYRALVHDNPDLVQFFQVVTPIEEI
SKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALATELKADPDQME
MLRMLNQRWPFFRMLISKVEMTLSKVDLDVAHHYVVSLGGSDDRDAFASIFDIISSEYSL
TKKLILEITGKSKLLSADPALQLSVNLRNRTIVPLGFLQVALLKRLRDQNRQPPISEDVS
IDSTQSSRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaatccttctaacgaaaatatctctaatcactcgacagtatgtgttgaggat
caagatcctggatctttattgcaacaaaggcttgaactagtggaggatctatggaaaacc
gttctcaaaagtgaatgtccacctgatcaaacagagagattattgcgattaaaacaatta
agtgatcctagtaagtcaaatcaagacaattcctcaaaggcaatagtccaattgattaca
aaaatggatttggctgaggcgatatctgctgctagggctttttctctttattttcagttg
gtaaacattctggagcaacgcatagaagaggatagttatttagaaagcatagaaaaaggg
aagttagacaccagtaattataaaatagatccattcgctccagctttagctagtcagact
gctccagcaacttttacacaattatttgagcgattacgtcgtttgaatgtccctccagct
cagcttgatggtttgatgagagaaatggatattcgtcttgtttttacagctcatccaact
gaaatagttagacacacggttcgccataagcaacgcagggttgccactcttttgcagcaa
cttcaatctaatagcttgatttccgaatcagagaaagaaatatttaggttgcagctagag
gaggagataagactttggtggagaactgatgagcttcatcagtttaaaccgactgtcctt
gatgaggttgactatgcccttcattattttcagcaggttttgtttgatgcaatgcctcaa
ttaagaaggagactgactaccgcacttgcttcaagttatccagacgtagagatccctaat
gaagctttttgcacatttggctcttgggtaggttcagatcgtgatgggaatccgtcagtt
actcctgaaatcacatggagaacagcgtgttaccaaagacaattaatgttggataggtat
attgcatcagttcaagatctaagagaccaactcagtatatctatgcaatggagtcaagta
agttctcctttgttagagtcattggaaatggacagagttcgtttccctgaggtttatgag
gaaagggctgcaagatatagactggaaccttatcgcttgaagcttagctatacacttgag
aggctacgacttactcaactacgtaataagcagctagcggatgctggatggcaattctca
cccgatgggaagccgcaaatatctactaataatagttttgatgaagtactccactacaaa
tctgtagaagaattaaaaaatgaattagagcttattagaaatagtttggttagtacagat
cttacttgtgaaccattagatactttgctaaatcaagttcatatttttgggttctcgttg
gctagtttagacattagacaagaaagcacacgacatagtgatgcgttggatgagctcact
cgctatttagatctccctgagtcgtatggagtgatgagcgaggaaagtcgagttcaatgg
ttgatgaaagaattaagaactcggagaccacttattccgccttcttttgagtggtctaaa
agtactcaagaaactatctcagtttttcatatgcttcataggcttcagaaagaatttggt
actcgtatatgtcgctcgtatgtaatttcgatgagtcatacggcatcagatttattagaa
gttcttcttttagctaaagagtcgggtttgattgatccaactttaggagcttctgatctt
cttgttgttccattatttgaaacggttgaggacttacaacatgctccttctgtaatggag
tcgttactacaatctgatgtttatcgcgaattacttccacgagtaggagagaaaaaacaa
ccgcttcaagaacttatgctgggatattccgatagtaataaggattctggttttctctca
agtaattgggaaattcataaggcccaaatagcactccaagacctagctagtagacaagga
atagcattacgtatttttcatggtagaggtgggtccgtaggaagaggcggtggaccagct
tatcaagctattttggctcaacctagtggtacacttcagggacgtataaaaataacagag
caaggggaagtacttgcttcaaaatatagtcttccagaattagctttatataatctggaa
actgtaaccactgcagttattcaaaatagcttggttaccaataaattggatgctacgcca
agttggaatgaattgatgaccagacttgcagctcgttcaagggagcattaccgagcttta
gttcatgataatccagatttagttcaattttttcaggtagttactccaatagaagagata
agtaagttgcaaatttctagtcgtcctgctcgacgaaagagtggtgcaaaagacttatca
agtcttcgagctatcccatgggtctttggttggactcaaagtcgtttccttttgccaagt
tggtttggtgttggtacggctttagctactgaattaaaggctgaccccgaccaaatggag
atgttgcgaatgttgaatcagagatggccattctttagaatgttgatatctaaagtagag
atgacactttcaaaagttgatttagatgttgcccatcattatgtggttagtttgggtgga
agtgatgatcgggatgctttcgctagcattttcgatattatctcaagcgaatacagcttg
actaagaaattaattttagaaattactggcaagtcaaaactattaagtgcagaccctgct
ttgcagttgtctgtcaacctgagaaataggactattgtccctttaggatttttacaagtt
gctcttctcaagcgattaagagatcagaatcgtcaaccaccaattagtgaagatgtaagt
attgactctactcaaagttctcgtacatatagccgtagtgaattattgcgtggtgcattg
ttgactatcaatggtatcgctgcaggtatgagaaacacaggatga

DBGET integrated database retrieval system