KEGG   Paraburkholderia megapolitana: FNZ07_08530
Entry
FNZ07_08530       CDS       T06515                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pmeg  Paraburkholderia megapolitana
Pathway
pmeg00440  Phosphonate and phosphinate metabolism
pmeg00998  Biosynthesis of various secondary metabolites - part 2
pmeg01100  Metabolic pathways
pmeg01110  Biosynthesis of secondary metabolites
pmeg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmeg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    FNZ07_08530 (aepX)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    FNZ07_08530 (aepX)
Enzymes [BR:pmeg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     FNZ07_08530 (aepX)
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL NTP_transferase IspD
Other DBs
NCBI-ProteinID: QDQ81202
LinkDB
Position
1:2026570..2028273
AA seq 567 aa
MNARDPSILTASRSSRLRQMLTSNQLEFMMEAHNGLSARIVKEAGFRAIWGSGLAISAQY
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGERQPLAEMDEFCGKIKAGKDSQSDDDFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILTFAREWAGRGPLVIVPTKYYSTPTEVFRKAGISV
VIWANHLIRSAASAMQAVAKEIHDNETLVDVEDRIAAVNEIFRLQDADEYSEAERRYLSA
SRATGAAIVLAASRGAGLEALTEERPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNERHAQTGELASLACAADTLQTDTVISYGDLLFRSYIVRDLVESEAE
FSVVVDSSLTQAENSSVRDFAWCSAADDRGLFGNKVLLQRISSELQGDASSGTAPQGRWI
GLLNVRGAGIERLKAVLAQLRERPDFDSLDIPALLNALIDAGEQVEVQYVHGHWRGVNDL
EDFRRAGDFAHAQTPLASGDAQRGAAQ
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgaacgcacgagacccctccattcttaccgcctcccgcagcagccgcctgcgtcagatg
ctcaccagcaaccagctcgaattcatgatggaagcgcacaacggcctgtccgcgcgcatc
gttaaagaagccgggttccgcgcgatctggggctcgggcctcgcgatttccgcgcagtac
ggcgtgcgcgacaacaacgaggcgagctggacccaggtggtcgacacactcgagttcatg
gccgacgcaagcgatctgcccattttgctcgacggcgacaccggctacggcaacttcaat
aacgtacgacgcctcgtgcgcaagctcgaacagcgcggcatcgcaggcgtgtgtatcgaa
gacaagcagtttccgaagaccaacagctttatcaacggcgagcgtcagccgcttgcggaa
atggacgagttctgcggcaagatcaaggccggcaaggactcgcagtccgacgacgatttc
tcgatcgtcgcgcgcgtcgaagcgctgatcgcgggctggggcatggacgaagcgctgcgt
cgcgccgaggcatatcgccaggcgggcgccgatgcgatcctgatccacagcaagctgtcg
cgtcccgatgaaattctcacgttcgcacgcgaatgggccggccgcggtccgctcgtgatc
gtgccgaccaagtactactcgacgccaaccgaagtgttccgcaaggccggcatcagcgtc
gtgatctgggcgaaccatctgatccgttcggcagcatcggcgatgcaggctgtcgcgaag
gaaatccacgacaacgaaacgctcgtcgatgtcgaagaccgcatcgcggcagtcaacgaa
attttccgtctgcaggatgccgatgaatattcggaagccgagcgccgctatctgtcggct
tcgcgtgcgaccggtgctgcgatcgtgctcgcggcgagccgcggtgcaggactcgaagcg
ctgaccgaagagcgtccgaaagtcatgctgccggtggcgggcaagccgctgctgcgctgg
ctcgtcgatggcttcaagaagcagggcgtcaacgacatcacggtggtcggcggttatcgt
gccgacgcgatcgatacggccggcatcaagctcgtcgtcaacgaacgccatgcgcaaacc
ggcgaactcgcatcgctcgcatgcgccgccgacacgctgcagaccgacacggtcatttcg
tacggcgatctgctgttccgtagctatatcgtgcgtgatctggtcgaaagtgaagcggag
ttcagcgtcgtcgtcgattcgtcgctgacgcaggcggaaaacagcagcgtgcgcgacttc
gcatggtgctccgccgccgacgaccgcggtctgttcggcaacaaggtgctgctgcaacgc
atctcgagcgaactgcagggcgatgcctcgagcggcacggcgccgcagggtcgctggatc
ggacttctgaatgtgcgcggcgcgggcatcgaacgtctgaaggcagtgcttgcgcaactg
cgcgagcggcccgatttcgattcgctcgatattccggcgctgctcaatgcgctgatcgat
gcgggcgagcaggtcgaagtgcagtacgtgcatggccactggcgcggtgtgaacgatctg
gaagacttccgtcgtgccggtgatttcgcgcacgcgcagacaccgctcgcatctggcgat
gcgcaacgcggggctgcgcaatga

DBGET integrated database retrieval system