KEGG   Paraburkholderia megapolitana: FNZ07_11135Help
Entry
FNZ07_11135       CDS       T06515                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pmeg  Paraburkholderia megapolitana
Brite
KEGG Orthology (KO) [BR:pmeg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FNZ07_11135 (ahpF)
Enzymes [BR:pmeg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FNZ07_11135 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 Glutaredoxin K_oxygenase FAD_binding_3 DAO FAD_oxidored FMO-like Thi4 NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QDQ81665
LinkDB All DBs
Position
1:2613529..2615118
Genome map
AA seq 529 aa AA seqDB search
MLDANLKTQLKTYLEKLTRPIELVASVDDSAKSQELLALLNDVASLSARVTVIERRGDEQ
RKPSFSIGEPGKDTGIRFAGIPLGHEFTSLVLALLQVGGHPVKLDDAVIEQIRELDGDYR
FETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQDEVETRQIMAVPTVYMNGEV
FGQGRSGVKEILAKLDSGAGARAAKALQNKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVKSYEVDIMDVQRAEALIPGRIHE
VHLASGAVLRAKTIVLATGARWREIGVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVSHVTLFEYNAQLRADEVLQRKLRSLANVTIVTQAQTVEITGDGRKV
NGIVYRERVSGETKHVELEGVFVQIGLVPNTEWLKGTVDLSKHGEIVIDAKGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKAALGAFDHLIRSSVEEESPRDEALVEA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgccaatctcaagactcagttaaagacgtacctggaaaagctcacccggccg
atcgaactggttgcgtcggtcgacgacagtgcgaaatcgcaggaactgctcgcgctgctg
aacgacgtcgcgtcgctgtcggcacgcgtgacggttatcgaacgtcgcggcgatgaacaa
cgcaagccgtcgttctcgatcggcgagccgggcaaggacacgggtattcgctttgccggc
attccgctcggccatgaattcacgtcgctcgtgctggcgctgctgcaggtgggcggccat
ccggtcaagctcgacgatgcggtgatcgagcagattcgcgagctcgatggcgactatcgt
ttcgaaacctatatttcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcgctgatcaacccgcgcatccagcaggtcacgatcgatggcgcgctgtttcag
gacgaggtcgagacgcgccagatcatggccgtcccgaccgtgtacatgaacggtgaggta
ttcggtcagggtcgcagcggtgtgaaggaaattctcgcgaagctcgatagcggcgctggc
gcacgcgcagccaaagcgttgcagaacaagccggtgttcgacacgttgattgtcggcggc
ggtccggctggtgcggcggccgcgatctattcggcacgcaagggcattgcgaccggagtg
gtggccgaacgctttggcggccaggtgctcgatacgctcgccatcgaaaactttgtctca
gtgcaggaaaccgaaggaccgaagttcgcgaccgcgctcgaacagcacgtgaaaagctac
gaagtcgacatcatggatgtgcagcgcgccgaagcgctgattccaggccgcattcacgaa
gtgcatctggcgagcggcgcagtgctgcgcgcaaagacgatcgtgctcgcgaccggcgcg
cgctggcgcgaaatcggtgtgccgggcgagcgcgagtatcgcaatcatggcgtcgcgtat
tgcccgcattgcgatggtccgttgttcaagggcaagcgcgtggcggtgatcggcgggggt
aactcgggtgtcgaggcggccatcgatctggccggtatcgtgagccatgtgacgctattc
gaatacaacgcgcaactgcgtgccgacgaggtgctgcaacgcaagctgcgcagcctcgca
aacgtgacgatcgtcacgcaggctcagaccgtcgagattaccggcgacggccgcaaggtc
aacggtatcgtctaccgggaacgcgtatcgggcgagacgaaacacgtcgaactcgaaggt
gtgttcgtgcagatcggcctcgtgccgaataccgagtggctgaaaggcactgtcgatctg
tcgaagcacggcgagatcgtcatcgatgcgaagggcgcaacgtcggtgcccggcgtattc
gccgccggcgatgtaacgacggtgccgttcaagcagatcgtgatcgccgtgggggaaggg
gcgaaagccgcactcggcgcattcgatcatctgatccgcagctcggtcgaagaagaaagc
ccgcgcgacgaggcactggtcgaagcctga

DBGET integrated database retrieval system