KEGG   Paraglaciecola mesophila: FX988_01656Help
Entry
FX988_01656       CDS       T06389                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pmes  Paraglaciecola mesophila
Brite
KEGG Orthology (KO) [BR:pmes00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FX988_01656
Enzymes [BR:pmes01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FX988_01656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored DAO HI0933_like FAD_binding_2 FAD_binding_3 NAD_binding_8 NAD_binding_7 Thi4 AlaDh_PNT_C FMO-like Glutaredoxin K_oxygenase Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: QHJ11427
LinkDB All DBs
Position
complement(1922289..1923881)
Genome map
AA seq 530 aa AA seqDB search
MLDAKLKGQLATYLENLTSQVELRIAVDEQHQAKKSAEISDLANDIAELSPLVKVVAQSK
NDVRKPSMEVVSVKNNTSITFAGVPMGHEFTSLVLALLNSGGHPVKISEEQVTEIKALSG
SYQFETYVSLSCQTCTGVVQALNVLSVINPNITNTMIDGSLFQDEVNERNIMSVPSVYLN
GELFTQGAVTIDKILSKIDPHADAKQAESLNDKDPYDMLIVGGGPAGAAAAIYAARKGIR
TGIVAEKFGGQVTDTMAIENFISVKATEGPKLVTGLEQHVKDYNVDIMDNNKAVKLSKDG
LINIELENGAMLSSKTVMLATGARWREMNVPGEQQYRGAGVAYCPHCDGPLFKGKRVAVI
GGGNSGIEAALDLANIVEHVTVLEFDTKLRADEVLQRKAKAAKNIDIILNAMTTEVLGDG
KRVTGLTYQDRVSQESKHVELAGIFVQIGLVPNSEWLKGDIALTPRGEIEVGQRGETSIE
GVFAAGDVTTAPYKQIIIAMGDGANAALGAFDYLLRAPSVESANDSEKAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgcaaaattaaaaggccaattggccacctatttagaaaacctcacttcacaa
gtggagttacgtatcgctgttgatgagcaacatcaagcaaaaaaatcagcagaaataagc
gaccttgccaatgacattgctgaattatcacccttagtcaaggtggtagcgcagagcaaa
aatgatgttcgaaaaccatcgatggaagtcgtttctgttaaaaacaatacctccattacc
tttgcaggggtaccaatgggacacgagttcacctcgttagtattggctctgttaaatagt
ggtggtcacccggtaaaaatcagcgaagagcaagtgaccgaaattaaggcgctctctggt
tcttatcaatttgagacatacgtttcgttgagctgtcagacatgcacaggggtagtgcaa
gcattaaacgtgttgtctgttattaacccgaatattaccaacaccatgatcgatggttcg
ttatttcaagacgaagttaatgaacgcaatattatgtcggtcccgagtgtgtacttaaat
ggcgaactgttcacccaaggtgcagtaaccatagacaaaattctaagcaaaattgacccg
cacgctgacgcaaagcaagcagagtcattaaatgataaagacccttacgacatgctcatt
gtcggtggcgggccagctggcgctgcagcggctatttatgctgcacgtaaaggtattcgc
accggcattgtggctgaaaagtttggcggtcaagtgacggataccatggccattgaaaac
tttatttcagtgaaagccaccgaaggtccaaagctagttaccggacttgagcagcacgtc
aaagattacaacgtggacatcatggataacaacaaagcggtgaagttatcaaaagacggt
ttgatcaatatcgaactagaaaatggcgcgatgttatccagcaaaacagtgatgctagcc
acgggtgcaagatggcgtgaaatgaatgtaccaggagagcagcaatatcgtggtgcaggt
gtcgcctattgcccacactgtgacgggccgttatttaaaggcaagcgagtggcggtaatc
ggaggcggtaactcaggtatagaggccgcgctagatttagcgaatatcgttgaacacgtc
accgttcttgagtttgatactaagttgcgtgcagatgaagttttgcaacgtaaagccaaa
gcagccaagaatatcgacattattcttaatgccatgaccacagaagtgcttggcgatgga
aagcgcgtaacaggcttaacctatcaagaccgcgtaagccaagaaagcaaacatgttgag
ttggcaggtatctttgttcaaattggtttggtgcctaatagtgagtggttaaaaggtgat
atagcgttaaccccacgtggtgaaatagaagtcggccaacgcggtgaaacttcaattgaa
ggcgtatttgccgcaggagacgtcactaccgccccctataagcaaatcatcattgccatg
ggcgatggagcaaatgcagccctaggcgcgtttgattacttattacgtgcgccgtcagtt
gaaagcgcaaatgacagcgagaaagccgcctaa

DBGET integrated database retrieval system