KEGG   Prochlorococcus marinus MIT 9303: P9303_08091Help
Entry
P9303_08091       CDS       T00466                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00630  Glyoxylate and dicarboxylate metabolism
pmf00710  Carbon fixation in photosynthetic organisms
pmf01100  Metabolic pathways
pmf01120  Microbial metabolism in diverse environments
pmf01200  Carbon metabolism
Module
pmf_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmf_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmf_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    P9303_08091 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9303_08091 (rbcS)
Enzymes [BR:pmf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     P9303_08091 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABM77560
CYORF: P9303_08091
UniProt: A2C7V0
LinkDB All DBs
Position
739134..739475
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPVIEHVHPSGSMQTYWS
YWKLPFFGEKDLNAVVSELEACHRAYPDHHVRMVGYDAYTQSQGTAFVVFEGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcacagttggtgactatcaaacagtcgccaccctggaaaccttcggc
tttttaccgccgatgacccaggacgaaatttacgatcaaattgcctacatcattgctcag
ggatggagccctgtgattgagcacgttcatccaagcggttccatgcagacctattggtct
tattggaagttacctttctttggcgagaaggatctgaatgcggtagtcagtgagcttgag
gcttgccatcgtgcatacccagaccaccatgttcgcatggtcggttacgacgcttacacc
caaagtcaaggaactgcattcgtagtatttgaaggacgctga

DBGET integrated database retrieval system