KEGG   Prochlorococcus marinus MIT 9303: P9303_18041Help
Entry
P9303_18041       CDS       T00466                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00250  Alanine, aspartate and glutamate metabolism
pmf00410  beta-Alanine metabolism
pmf00430  Taurine and hypotaurine metabolism
pmf00650  Butanoate metabolism
pmf01100  Metabolic pathways
pmf01110  Biosynthesis of secondary metabolites
pmf01120  Microbial metabolism in diverse environments
pmf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    P9303_18041
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P9303_18041
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    P9303_18041
   00430 Taurine and hypotaurine metabolism
    P9303_18041
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    P9303_18041
Enzymes [BR:pmf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     P9303_18041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABM78546
CYORF: P9303_18041
UniProt: A2CAN6
LinkDB All DBs
Position
1570942..1572381
Genome map
AA seq 479 aa AA seqDB search
MALHRSNPRSNDLEEHAIWETVDALVSPLPRATFPQECRPALTTFNLLKEELLLDGNSKQ
NLATFCQTYESHQVADLMALAVDKNLIDKDEYPQTAEIERRCVSMMADLWHAPGEAVGCS
TIGSSEAAMLGGLAAKWRWREHRKAAGQSIDRPNMVCGSVQICWTKFARYWDVELREVEM
TSGELCMSPERMLEQVDENTIVVVPTLGVTYHGLYEDVQAISQALDELQQRKGLDIPIHV
DAASGGFLAPFCAPDLAPWDFRLPRVKSINSSGHKFGLAPLGVGWVLWRESSDLPEGLVF
HVSYLGGDMPTFQINFSRPAGQVISQYYDFVRLGRDGYQAIHGASYANAQYVAQELKKLG
PFELIHDGNPARGIPTVVWTLRAGQELGFNLYDLSDRLRLRGWQVPAYPFTGELAHQAFQ
RILVKRDFSREMADLLLTDIRNAITHFESHPVKISLNATEAASTNHLGRSMVESLDAHG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcatcgttctaatccccgctccaacgatctggaagaacatgccatttgggaa
accgttgatgcattggtctcaccattaccacgcgcgacttttccgcaagagtgccgtcct
gcattgacaacatttaatttgctcaaggaggagttattgcttgacggcaacagcaaacaa
aatctggccaccttctgtcagacctatgaaagtcaccaggtggctgatctaatggccctc
gcggttgacaagaacctgatcgacaaggacgaatatccccaaaccgcagagattgaacgc
cgttgtgtttcgatgatggctgatttatggcacgcccccggtgaagctgtgggctgctcc
accatcggtagcagtgaggccgccatgctgggtggcttggctgcgaaatggcgttggcgt
gaacatcgcaaagcggcaggtcagtcgatcgatcgccccaacatggtttgcggcagtgta
caaatctgctggacgaaatttgcccgctactgggacgttgagttgcgggaggtggagatg
acctccggcgagctctgcatgtctccagaacgaatgctggagcaagtggatgagaacacc
atcgttgtggtgcctaccctgggcgtcacttatcacggcctgtatgaagacgtacaagcc
atcagtcaggccctcgatgagctgcaacagcgaaaaggactcgacattcctatccatgtg
gatgcagccagcggtggctttcttgctcctttctgtgcccctgatctggctccctgggat
ttccgtttgccgcgcgtgaagtcaatcaactcctctggccataagttcggcttagctcct
ctgggtgtgggttgggttctttggcgtgagtccagtgatcttccggaaggattggttttc
catgtgagttacctaggaggcgatatgccaacgtttcagatcaacttctcgcggccagcg
gggcaggtgatctcccagtactacgactttgtccgcctaggtcgcgatggttatcaagcc
atccatggagcgagctatgccaatgctcaatatgttgctcaagaactcaaaaagctaggc
ccatttgaattgatacacgatggcaacccagcacgtggcatccccactgtggtgtggaca
ttgcgagccggccaagagcttggtttcaacctttacgacctctctgatcgactgagatta
cgtggttggcaagtgccagcttatccattcacaggtgagcttgctcatcaagcctttcag
cggatcttggtaaaacgcgatttctcacgtgaaatggctgatctcctacttaccgacatc
cgcaacgccataactcatttcgagagtcatcctgtcaagatcagtcttaacgctactgaa
gcagcgtctactaatcatctcggccgttcaatggttgaatcccttgatgcgcatggatga

DBGET integrated database retrieval system