KEGG   Prochlorococcus marinus MIT 9303: P9303_21291
Entry
P9303_21291       CDS       T00466                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00010  Glycolysis / Gluconeogenesis
pmf00020  Citrate cycle (TCA cycle)
pmf00620  Pyruvate metabolism
pmf01100  Metabolic pathways
pmf01110  Biosynthesis of secondary metabolites
pmf01120  Microbial metabolism in diverse environments
pmf01200  Carbon metabolism
Module
pmf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9303_21291 (pdhC)
   00020 Citrate cycle (TCA cycle)
    P9303_21291 (pdhC)
   00620 Pyruvate metabolism
    P9303_21291 (pdhC)
Enzymes [BR:pmf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P9303_21291 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF711
Other DBs
NCBI-ProteinID: ABM78864
CYORF: P9303_21291
UniProt: A2CBK4
LinkDB
Position
complement(1893868..1895187)
AA seq 439 aa
MPALSSTMTEGKIVEWLKQPGDKVGRGESVLVVESDKADMDVESFQDGYLAAVLMPAGRS
APVGETIGLIVESEAEIAAVQANAPAAPASDPAPLKAAAKVVDDHAPASTPAPVVESPPV
AAPPPVTSQAVESDKRIVASPRAKKLAAQMGVDLAKLRGSGPHGRIQAEDVQLAAGQPIS
VPQVAEGNASFATTHATSAGVAHAVSSPVGQSFGAPGETAAFNNLQQAVNRNMEASLAFP
CFRVGYTITTDQLDAFYKQVKPKGVTMTALLAKAVALTLVRHPQVNAAYSTAGMVYPEQV
NVAIAVAMDDGGLITPVLQNADRTDLYEMSRQWADLVKRSRSKQLQPEEYSTGTFTLSNL
GMFGVDRFDAILPPGTGAILAVAASRPAVVAGKDGSIGVKRQMQVNLTADHRVIYGADGA
AFLKDLAELIETRVESLAL
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcctgctctgagctcaacgatgacggagggcaagatcgttgagtggcttaagcaacct
ggcgacaaggttgggcgtggtgagtcggtgcttgtggtggagtcagataaagcggatatg
gatgtggagtcatttcaagatggctacttggccgcggtcttgatgcctgctggtcgttcg
gctccagtgggtgaaacgattggtttgatcgttgaaagtgaggccgaaatcgcggctgtt
caggccaatgcccctgctgcgccagcgtctgatcctgcccctctcaaggccgctgcaaaa
gttgtcgatgaccatgccccagcatctactccggcgcccgtcgtggagagtccccctgtt
gctgcgccgccgcctgttaccagccaagcagtagagagtgacaaacgcatcgttgcttcc
ccgcgggctaaaaaacttgctgcgcagatgggtgttgatctggccaagttgagaggtagc
ggaccccatggccgtatccaggctgaagacgtgcagctggctgcaggtcagccgatcagt
gtgcctcaggttgctgaaggaaacgcttctttcgcaacgacgcatgcaacttctgcaggc
gttgctcatgcagtgtcatctcctgtaggtcagagctttggggccccgggagaaaccgca
gccttcaacaacctccaacaagcggtcaaccgcaatatggaggccagtttggccttcccc
tgcttcagggttggctacacgatcacgactgatcagttggatgctttttacaagcaggtg
aagcctaagggcgtcacgatgacagcccttctggccaaagccgtggccttgacgcttgtg
cgtcatccccaggtgaatgctgcctacagcactgctgggatggtttatccagagcaggtg
aatgttgctattgcagtggcgatggacgatggcggtctgattacaccggttttgcagaat
gctgatcgcactgatctctatgagatgtcgcggcagtgggccgatcttgtgaagcgttca
cgcagcaagcagctgcaacccgaggaatacagcactggtactttcacactctccaatctg
ggcatgtttggtgtggatcgctttgatgcaatcttgccccctggcactggcgcaattttg
gcggtagctgcatcgcggcctgctgtggtggcaggaaaggatggctcgattggggtcaag
cgccagatgcaggtgaacctcactgccgaccatcgcgtgatttatggcgccgatggggcg
gccttccttaaggacctggcagagctgattgagacgcgggtagagagtttggcgctctga

DBGET integrated database retrieval system