KEGG   Prochlorococcus marinus MIT 9303: P9303_22741Help
Entry
P9303_22741       CDS       T00466                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
pmf00620  Pyruvate metabolism
pmf00680  Methane metabolism
pmf00710  Carbon fixation in photosynthetic organisms
pmf01100  Metabolic pathways
pmf01120  Microbial metabolism in diverse environments
pmf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P9303_22741 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9303_22741 (ppc)
   00680 Methane metabolism
    P9303_22741 (ppc)
Enzymes [BR:pmf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     P9303_22741 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABM79009
CYORF: P9303_22741
UniProt: A2CBZ9
LinkDB All DBs
Position
2009618..2012626
Genome map
AA seq 1002 aa AA seqDB search
MAKPESTSASMQQSSAQKPDCDQPRAIGEGQQAGRLLQNRLELVEDLWQTVLRSECPPDQ
AERLLRLKQLSEPLALEGADENSASTAIVLLIKEMDLAEAITAARAFSLYFQLVNILEQR
IEEDSYLASMSSGKENNRQDKPYDPFAPPLATQTDPATFSELFERLRLLNVPPAQLETLL
QEMDIRLVFTAHPTEIVRHTVRHKQRKVANLLQQLQSDPTKSSSEKESLRLQLEEEIRLW
WRTDELHQFKPSVLDEVDYALHYFQQVLFDAMPQLRRRLITAMAESYPDVHIPQAAFCTF
GSWVGSDRDGNPSVTPEITWRTACYQRQLMLERYVNAVQKLRDQLSISMQWSQVSTPLLE
SLEMDRLRFPEVYEERAARYRLEPYRLKLSYTLERLKLTQERNQQLAEAGWQTPPEGLNP
SLNLINAGEALHYKSVAEFRSDLELIRNSLVSTDLSCEPLDTLLNQVHIFAFSLASLDIR
QESTRHSDALDELTRYLNLPKAYGDMAENERVQWLIEELQTRRPLIPSAVIWSPSTAETV
AVFRMLHRLQEEFGSRICRTYVISMSHTVSDLLEVLLLAKEAGLVDPAAGHAELLVVPLF
ETVEDLQRAPAVMEALLSSPVYRNLLPRVSEQVQPLQELMLGYSDSNKDSGFLSSNWEIH
QAQIALQDLANRQGVALRLFHGRGGSVGRGGGPAYQAILAQPSGTVRGRIKITEQGEVLA
SKYSLPELALYNLETFTTAVLQNSLVTNQLDATPSWNQLMTRLAGRSREHYRALVHNNPD
LVAFFQQVTPIEEISKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGT
ALAAEVESDADQLDLLRRLHQRWPFFRMLISKVEMTLSKVDLDLAHHYMTSLGSEDYREA
FNRIFEIIETEYSLTRRLVLNITGQPRLLGADPALQQSVDLRNRTIVPLGFLQVALLRKL
RDQNRQPPMNEAGDGRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacctgagtccactagcgcatcgatgcagcagtcttccgcccaaaaacctgat
tgcgatcagcccagggcaatcggggaagggcagcaggcaggacgcttactgcagaaccgc
cttgaactggtggaagacctttggcaaacggtgctacgcagcgaatgtccaccggatcag
gcagaacgactacttcgactgaagcaactcagtgaacctttggcccttgaaggtgcagat
gagaacagtgccagcacagcaatcgtgctgttgatcaaagagatggacctggcagaagcg
atcaccgcagcacgcgccttctccctctatttccaactggtgaatatcctcgagcaacgg
atcgaggaagacagctacctcgcaagtatgtcttctggcaaagaaaacaatcgccaagac
aaaccctatgacccctttgctccaccgctcgccacgcagacagacccagccacattcagc
gagctgttcgaacgacttcgcctgctcaacgtgccaccagctcagctggagacccttcta
caggagatggatatccgcctagttttcactgctcatcccactgaaatcgtccgtcatacc
gttcgccataagcaacgcaaggttgcaaacctgttgcaacagttgcaatcagatccaaca
aaatcgtcatctgaaaaagaaagcctgagactgcagcttgaggaggagatcaggctctgg
tggcggaccgatgagcttcatcagttcaagccctccgttctggatgaggtggattacgcc
ctccactatttccaacaggtgctttttgatgccatgccccagctacggcgtcgcctgatc
actgcaatggccgagagctatccagatgtacacattccacaagctgccttctgcactttt
ggatcttgggttggatcagaccgagacggcaatccttccgttacaccagaaatcacctgg
cgcaccgcctgttatcaacgtcagctgatgctggagcgctatgtcaatgccgttcaaaaa
ctccgtgatcaactcagcatctccatgcaatggagccaggtaagcactccactgttggag
tcactggaaatggaccggcttcgattccccgaggtttacgaggaacgagcagcccgctat
cgactcgagccttatcgcctcaaactcagctacaccctggagaggttgaaactcactcaa
gaacgcaaccagcaattggccgaagcaggctggcaaaccccaccagaaggcctcaacccc
agtctcaatctaattaatgcgggagaagcccttcactacaaatcagtagcagaattccgc
agcgacctggaactgatccgcaacagcctggtcagcacagatctgagctgtgagcctctg
gataccctcttaaatcaggtccacatcttcgctttctcactagccagcctcgacatccgt
caggagagcactcgccacagcgatgctctcgacgaattaacccgctacctaaacctgcct
aaggcctatggcgacatggccgaaaatgagcgggtgcaatggttaatagaggaactacag
actcgccgccccctgatcccctctgccgttatctggtcgcccagtacagcagaaacggtg
gccgtgtttcgcatgctgcaccgacttcaggaggaattcggcagccgaatctgccgcaca
tatgtgatctcaatgagtcacacagtttccgatctactcgaggtgctgctgctagccaaa
gaagccggcctcgtggatccggcggctggccatgccgaactgcttgtggtgcccctattc
gaaaccgtagaggatctccagcgggctccagcagtgatggaggcacttttaagttcacct
gtctaccgcaatttgctccctcgtgtcagcgaacaggtccaacctctgcaggagctgatg
cttggctattcggacagcaacaaagactccggatttctatccagcaattgggagatccat
caagcccaaattgccctgcaagatctagctaaccgccagggtgtggctctgcgccttttc
catggacgcggtggatctgttggcagaggaggtggccctgcctaccaagcaatccttgcc
caaccaagcggaaccgtgcgcggccgaatcaagatcactgagcagggagaagtgctggca
tcgaaatacagcctgcccgagctagccctttacaacctagaaacattcactacggccgtc
ctgcaaaacagtctggtaaccaaccagctggatgccaccccaagctggaaccaactgatg
accagactggctggtcgttcacgtgagcactatcgggccctcgtccacaacaaccctgat
ctggtggccttcttccaacaggtcacgccgatcgaagaaatcagcaaattgcaaatctcc
agccgtcctgctagacgcaaaagcggcgccaaggacctctctagcctacgagcgatcccc
tgggtatttggctggacgcaaagtcgctttctactaccgagctggtttggcgtgggaaca
gcactagccgcggaagtcgaatcagacgctgaccagcttgaccttctgcgcagactgcac
caacgctggccattcttccgaatgctgatctccaaggtggagatgaccctttcaaaagta
gacctagacctggcccatcactacatgactagccttggcagcgaagattaccgtgaagcc
tttaaccgtatcttcgagatcatcgaaacggagtacagcctcacccgccggttggtctta
aacatcaccggacaacccaggttgctcggggccgatcccgccctacagcaatcagtagat
cttcgcaatcgcacgatcgtgccacttggttttctgcaagtggccctgcttcgcaaactg
cgtgatcagaaccggcagccaccaatgaacgaggctggcgatggtcgcacatacagccgc
agcgaacttctaagaggcgcactgctcaccattaacggcattgctgcaggcatgcgcaac
accggttga

DBGET integrated database retrieval system