KEGG   Prochlorococcus marinus MIT 9301: P9301_05771Help
Entry
P9301_05771       CDS       T00488                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00630  Glyoxylate and dicarboxylate metabolism
pmg00710  Carbon fixation in photosynthetic organisms
pmg01100  Metabolic pathways
pmg01120  Microbial metabolism in diverse environments
pmg01200  Carbon metabolism
Module
pmg_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmg_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    P9301_05771 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9301_05771 (rbcS)
Enzymes [BR:pmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     P9301_05771 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABO17200
CYORF: P9301_05771
UniProt: A3PBS5
LinkDB All DBs
Position
505109..505450
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVSDYQTVATLETFGFLPPMTQEEIYDQIAYIIAQGWSPVIEHVHPSGCMQTYWS
YWKLPFFGEKDLNLIVSELEACHRAYPDHHVRIIGYDAYTQSQGTAFVVFQGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcacagtaagcgactatcaaacagttgcaaccctggaaacattcggt
ttcttaccaccgatgacccaggaagaaatatatgaccaaattgcgtacataattgctcaa
ggttggagtccagttattgagcatgttcatccaagtggatgtatgcaaacttattggtct
tattggaaactcccattctttggggaaaaagatcttaacttgatcgtgagcgaattagag
gcatgtcatagagcataccctgatcatcatgtaagaatcatcggatacgatgcttacact
caaagtcaaggaacagcttttgtagttttccaaggacgttaa

DBGET integrated database retrieval system