KEGG   Prochlorococcus marinus MIT 9301: P9301_07771Help
Entry
P9301_07771       CDS       T00488                                 

Gene name
pstB
Definition
(GenBank) putative phosphate ABC transporter, ATP binding subunit
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pmg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    P9301_07771 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmg02000]
    P9301_07771 (pstB)
Enzymes [BR:pmg01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     P9301_07771 (pstB)
Transporters [BR:pmg02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    P9301_07771 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_22 AAA_16 AAA_23 AAA_15 RsgA_GTPase AAA_29 Rad17 AAA_18 AAA_33 AAA AAA_5 Adeno_IVa2 PRK ATP-synt_ab AAA_28 AAA_30
Motif
Other DBs
NCBI-ProteinID: ABO17400
CYORF: P9301_07771
UniProt: Q0GPK3
LinkDB All DBs
Position
675034..675843
Genome map
AA seq 269 aa AA seqDB search
MIKTNKKIPKNIILSLENVSISYGTFEAVRNVFCNFKKGNITSLIGPSGCGKSTVLRSLN
RMNDLIPNCSLKGTVLFDGTNIYDKRVDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARI
NGFTGDMDELVESSLKKAALWDECKDKLNDSGYSLSGGQQQRLCIARTIAIEPEIILMDE
PCSALDPISTLKIEETMHELKKNYTIIIVTHNMQQALRVSDMTAFFNAIEYEDGDGGKVG
YLAEFNSTKKIFSSPKEKTTQEYISGKFG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaactaataaaaaaataccaaagaatatcattttatctcttgagaacgtatct
attagctatggaacttttgaagccgtaagaaatgttttttgtaattttaaaaaaggaaat
ataacctctcttattggaccttcaggttgtggtaaatcaactgttcttagatccttaaat
aggatgaatgatctgatccctaattgttcgttaaaagggactgtcctttttgatggaact
aatatttacgacaaaagagtagatccagttgaagtaagaagaagaattggaatggttttt
cagcagcctaatccttttccgaaatctatttacgaaaatattgcatttggggcaagaatt
aatggctttactggagatatggatgaattagtagaaagttcactaaaaaaggctgcttta
tgggatgaatgtaaggataaattaaatgatagtgggtactcgttatctggcggacaacaa
caaagattatgtattgctagaactattgctattgagcctgaaataattctaatggatgag
ccatgttctgcattagatccaatctctactttaaaaattgaggagacaatgcatgaactt
aagaagaattacacaataataatcgttactcataatatgcaacaggcattaagagtcagt
gatatgactgcattttttaatgctattgaatatgaagatggtgatggaggaaaggttggt
tatcttgcagaatttaattcaacaaagaaaatttttagctctccaaaagaaaaaaccacc
caggaatacatatctggtaaatttggctga

DBGET integrated database retrieval system