KEGG   Prochlorococcus marinus MIT 9301: P9301_17661Help
Entry
P9301_17661       CDS       T00488                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmg  Prochlorococcus marinus MIT 9301
Pathway
pmg00620  Pyruvate metabolism
pmg00680  Methane metabolism
pmg00710  Carbon fixation in photosynthetic organisms
pmg01100  Metabolic pathways
pmg01120  Microbial metabolism in diverse environments
pmg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P9301_17661 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9301_17661 (ppc)
   00680 Methane metabolism
    P9301_17661 (ppc)
Enzymes [BR:pmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     P9301_17661 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABO18389
CYORF: P9301_17661
UniProt: A3PF64
LinkDB All DBs
Position
complement(1487262..1490231)
Genome map
AA seq 989 aa AA seqDB search
MESFRQIKNNNVDLISNNDPLDKNRLLIEDLWESVLREECPDDQAERLIQLKELSYSKQI
DGNSSKTFKNEIVDIVNSMDLAESIAAARAFSLYFQLVNILEQRVEEDRYIQSFTNKDVQ
KSPDNLDPFAPALARQNAPVTFRELFYRLRKLNVPPGKLEELLQEMDIRLVFTAHPTEIV
RHTIRHKQTRVANLLKKIQIEQFLTKDEKISLKTQLKEEVRLWWRTDELHQFKPSVLDEV
DYSLHYFQQVLFNAMPQLRGRITEALTENYPDVQLPPESFCNFGSWVGSDRDGNPSVTPD
ITWRTACYQRQLMLDRYIVATSNLRDQLSVSMQWSQVSSSLLESLETDRVKFPEIYEARA
TRYRSEPYRLKLSYILEKLRLTQERNNLLADSGWKFDFEGEIDNKNIDKVENLYYKSVNE
FTYDLELIKNSLISTDLTCDSVNNLLTQVHIFGFSLASLDIRQESTRHSDAIQELTNYLD
LSVQYDQMSEEEKIKWLIDELNTKRPLIPSDVNWTKTTEETFSVFKMVKRLQQEFGSRIC
HSYVISMSHSASDLLEVLLLAKEMGLLDQDSQKSKLLVVPLFETVEDLQRAPEVMEKLFK
LDFYKSLLPKVGESFKPLQELMLGYSDSNKDSGFVSSNWEIHRAQIALQNLSSRNNILLR
LFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELALYNLETVTT
AVIQNSLVNSRLDATPEWNQLMSRLAETSRSHYRKLVHENPDLLNFFQEVTPIEEISKLQ
ISSRPARRKKGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALSAELNSDPQQIELLRV
LHQRWPFFRMLISKVEMTLSKVDLEVARYYVDTLGSKENKDSFDNIFEVISKEYNLTKSL
ILEITGKNKLLESDRDLKSSVSLRNKTIIPLGFLQVSLLRRLRDQTRQPPISEFLIDKDE
SRRAYSRSELLRGALLTINGIAAGMRNTG
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggaatcttttcgacagataaaaaataataatgtggatctgataagtaacaatgatcca
cttgataaaaatcgtcttctaattgaagatctctgggaatctgtgctcagagaagaatgc
ccagatgatcaagcagagagattgatacagcttaaagaattaagttattcaaaacaaatt
gatggtaatagttcaaaaacttttaaaaatgaaatagttgatattgtaaattctatggat
ttagcagaatccatagctgctgcaagggcgttttcattatattttcaactcgtaaatatt
ttggaacaaagagttgaggaagatagatatattcaaagctttactaataaggatgttcaa
aaatcgccagacaatcttgatccttttgccccagcattggctaggcaaaatgctccagta
acttttagagaattattttacaggctgagaaaattaaatgtaccaccaggaaaattagag
gagttattacaggaaatggatattcgtttagtttttactgcgcatccgaccgagatagta
agacatacgattagacataagcaaaccagagtagcaaatttgttaaaaaaaatacagatt
gagcaatttctgacaaaagatgaaaaaatttctctaaaaacccaattaaaagaggaagta
aggctttggtggagaacagatgaattgcatcaatttaaaccttcagttttagatgaagtt
gattattcattgcattattttcagcaagttttatttaatgcgatgcctcaattgagaggc
aggattactgaagcacttaccgaaaattatccagatgttcagttgcccccagaatctttt
tgtaacttcggttcttgggtaggctctgatagggacggtaatccatcagtaactcctgat
ataacatggcgaactgcatgttaccaaaggcagttgatgttggatagatatattgttgcg
acgtctaatcttagagatcaattaagtgtatctatgcaatggagtcaagtaagttcctcc
ttattagaatcactcgaaactgacagggttaagttccctgaaatatatgaagctagagct
acaaggtatagatcagaaccttacagattaaaattaagttatattttagagaaattaagg
ttaacacaagaaagaaataatttattagctgatagtgggtggaaatttgactttgagggg
gaaattgataacaaaaatatagataaagttgaaaatttatattacaagtcagtaaacgaa
tttacatatgatcttgagctgattaaaaatagcttaattagtacagatttaacttgcgat
tctgtaaataacttacttactcaggttcatatttttggattttctttagcaagtttagat
attcgtcaagagagtacaaggcatagtgatgctattcaagagcttacaaattatcttgat
ttgtctgttcaatatgaccaaatgtctgaggaagagaaaattaaatggctcatagacgaa
ttaaatacaaaaaggcctttaattccatctgacgttaactggacaaaaactacagaagaa
accttttcagtttttaagatggttaagagactacagcaagaatttggaagtcgcatttgt
cattcttatgtaatttcaatgagtcatagtgcatctgatttgcttgaagttctcttactt
gcaaaagaaatgggacttcttgatcaagattcacaaaagtcaaaattattagttgttcct
ctttttgaaactgtggaagatcttcaaagagcaccagaagtaatggaaaagttgtttaaa
ttagatttctataaatcattattgccaaaagtaggagaatcttttaaacctctacaagaa
ttaatgcttggatattctgatagtaataaagattcaggatttgtttctagtaattgggaa
attcatagagcccaaatagctcttcaaaatctctcaagtagaaataacatattgctaaga
ctttttcatggaagaggagggtctgttggtagaggaggcggaccagcatatcaggcaata
ttagctcaaccaagcggcactttaaaaggacgaataaaaataacagaacaaggtgaagtt
ttagcttccaaatatagtcttcccgaactggctttatacaatcttgagactgtaactaca
gcggtaattcaaaatagtttggtaaatagtagacttgacgctacgccagaatggaatcaa
ttaatgtctaggctggcagaaacatcaagatctcattacagaaaattagtgcatgagaat
cctgatttgttaaatttctttcaagaggtcactccgatagaagaaataagtaaattacag
atatctagtaggcctgctagaagaaaaaaaggtgcaaaagatttgtcaagtttaagagct
attccatgggtatttggctggacacaaagtagatttcttttgccaagttggtttggagta
ggcactgctttgtcagctgaattaaattcagatccacaacaaattgaactattaagagtt
ctgcatcaaagatggccattttttaggatgcttatatctaaagtggaaatgacattatcg
aaggtggatctggaagttgctagatattatgttgatactcttggcagcaaagaaaataaa
gactcttttgataatatttttgaagtaatttctaaagaatataatcttacaaaatcttta
atacttgaaattactggtaaaaataagctcctagaatctgatagagacttgaaatcatca
gtaagcttgagaaataagacaataattccattagggtttttgcaggtttcacttctaaga
agattaagagaccagacaagacaacctccaataagcgaattccttatagataaggacgaa
tccagaagagcttacagcagaagtgaactattaaggggtgcacttttaactattaatggg
atagcagctggcatgagaaatacaggttga

DBGET integrated database retrieval system