KEGG   Prochlorococcus marinus MIT 9215: P9215_04811
Entry
P9215_04811       CDS       T00598                                 

Gene name
odhB
Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00010  Glycolysis / Gluconeogenesis
pmh00020  Citrate cycle (TCA cycle)
pmh00620  Pyruvate metabolism
pmh01100  Metabolic pathways
pmh01110  Biosynthesis of secondary metabolites
pmh01120  Microbial metabolism in diverse environments
pmh01200  Carbon metabolism
Module
pmh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9215_04811 (odhB)
   00020 Citrate cycle (TCA cycle)
    P9215_04811 (odhB)
   00620 Pyruvate metabolism
    P9215_04811 (odhB)
Enzymes [BR:pmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P9215_04811 (odhB)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Sigma_reg_C MadL
Other DBs
NCBI-ProteinID: ABV50097
CyanoBase: P9215_04811
UniProt: A8G3B6
LinkDB
Position
421149..422516
AA seq 455 aa
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENKDEIASVQEQNKGNQPEVSTSDQVELVSNKTEEKPVVQTEN
INKEVEEVALKSEKLVPSFNSDQINAATSNASSRIIASPRAKKLASQMGVDLAKVHGSGP
HGRIQADDILKANGQPVSIPWIGEGGSPASIPGANLGVESKPETSGNSFGNPGETVKFNT
LQKAVNKNMESSLDVPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTLKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRSKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVGNIDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLAYLIENEPETLVS
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtctcacgaaatattcatgcctgccttgagttctactatgacggagggcaagattgtg
gaatggttaaaaaatccgggagataaggttgaaagaggcgaatctgtcttggttgttgaa
tctgacaaggcagatatggatgttgaatcttttcaagatggatatcttgcagcagtttta
atgcctgctggcagcactgctcctgttggagaaactattggtctcattgttgaaaacaag
gatgagatagcttcagttcaagaacaaaataaaggaaatcaacccgaagtctctacttca
gaccaagttgaattggtaagcaataaaactgaagaaaaaccagtagtccagactgaaaat
attaataaagaagtggaagaagtcgccttaaagagtgaaaagcttgttccatcttttaac
tccgaccaaattaatgccgctacaagtaatgcttcttcgaggataattgcatctccaaga
gctaaaaaactagcctctcaaatgggtgttgatttagcaaaggttcatggatctggcccc
catggaaggattcaagccgatgatattttaaaagctaatggccaacctgtctctatacca
tggataggggaaggtggttctcctgcaagtattcctggtgcaaatttgggagttgaaagt
aaaccagaaacgtcaggaaatagttttggtaatcctggagaaacagttaaatttaatact
cttcaaaaagcggtaaataaaaatatggaatctagtttagatgttccatgttttagggtt
ggatactctatcaatacagataaattagataatttctacaaaaaggtaaaacagaatgga
gtgactatgactgctttacttgtaaaggcagttgcaaagacactaaagaaacatcctcaa
gttaattcaagcttttcagaaaatggaatttcttatccagaaaatataaatattgcggtt
gctgttgcgatggaagatgggggactaataactccagtattaaaagaaccatgcaatact
gatttattcgaattatctagggaatggaaagatctcgtaaaaagatcgagatcaaaacaa
ttagaaccagatgaatactcaacgggaacatttaccttatctaaccttggtatgtttggt
gttgatagatttgatgcaatactacccccagggacaggtgcgatcttagcgatagcatca
tcgaaaccaactgttgtaggaaatattgatggttcaatatctgttaaaaaaataatgcaa
gtaaatcttacagctgatcacagagtgatttatggagctgatggtgcttcattcttgaaa
gacttggcttacctaattgaaaatgagccagagacacttgtatcttaa

DBGET integrated database retrieval system