KEGG   Prochlorococcus marinus MIT 9215: P9215_06321Help
Entry
P9215_06321       CDS       T00598                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00630  Glyoxylate and dicarboxylate metabolism
pmh00710  Carbon fixation in photosynthetic organisms
pmh01100  Metabolic pathways
pmh01120  Microbial metabolism in diverse environments
pmh01200  Carbon metabolism
Module
pmh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    P9215_06321 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9215_06321 (rbcS)
Enzymes [BR:pmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     P9215_06321 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABV50247
CyanoBase: P9215_06321
UniProt: A8G3R6
LinkDB All DBs
Position
556620..556961
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQEEIYDQIAYIIAQGWSPVIEHVHPSGSMQTYWS
YWKLPFFGEKDLNLVVSELEACHRAYPDHHVRIIGYDAYTQSQGTAFVVFQGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcacagtaggcgactatcaaacagttgcaaccctggaaacattcggt
ttcttaccaccgatgacccaggaggaaatatacgaccaaattgcatacataattgctcaa
ggctggagtcctgttattgagcatgttcaccctagtggaagtatgcaaacttattggtct
tattggaagctcccattctttggggaaaaagatcttaacttggttgtaagtgaattagag
gcatgtcatagagcataccctgatcatcatgtaagaatcatcggatacgatgcttacact
caaagccaaggaacagcttttgtagttttccagggacgttaa

DBGET integrated database retrieval system