KEGG   Prochlorococcus marinus MIT 9215: P9215_06471Help
Entry
P9215_06471       CDS       T00598                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pmh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    P9215_06471
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmh02000]
    P9215_06471
Enzymes [BR:pmh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     P9215_06471
Transporters [BR:pmh02000]
 Other Transporters
  Pores ion channels [TC:1]
   P9215_06471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N_4 GST_N Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-ProteinID: ABV50262
CyanoBase: P9215_06471
UniProt: A8G3T1
LinkDB All DBs
Position
complement(569098..570327)
Genome map
AA seq 409 aa AA seqDB search
MNRILTWDDLNKFEVEDLDRVHGINNSYANLRLFGHSENDVLVTLYRDRHSWCPYCQKIW
LWLEFKKIPYRVKKINMFCYGQKESWFVEKVRSGKLPAIEFKGQVITESDDIIAFLENAF
GALGSFITSSHLIKIRELEREIFRSWCNWLCRESFNFIDNSFRKKRFKESISKLDEILSS
SKSGFVDPSISNMGDIEPGVGDIIFIPYMERMNASLTYYKGFNLRSNYRHVDKWLTLFEG
TSAYRGTQGDFHTHAHDLPPQMGGCYKESNEKQITFSKLIDTGEGLGNYEFNQNYDSKYY
ATIALKRVIKHKENLLKVNPYNKESFEESLRSALTHMIKGEVLIPKKLSGISLKYLKNRI
SVPRDMPIISARLLRQSLNKIESLCDINEIDKIPFRHRYDQDPRNFISS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattttgacatgggatgatttaaataaatttgaagttgaagatctcgataga
gtccatggtataaataattcctacgcaaatttaagattatttggacatagtgaaaatgat
gtattagttaccctctatagggatagacattcttggtgtccttactgtcaaaagatatgg
ttatggcttgaatttaagaaaattccatacagagttaagaaaataaatatgttttgctac
ggccaaaaagaaagttggttcgttgaaaaagtcagatcggggaaattacctgcaattgaa
tttaaagggcaagttataactgaaagcgatgatatcatagcttttttagaaaatgcattt
ggagcacttggatcttttataacatcaagtcacctcatcaaaattcgagagttagaaaga
gaaattttcagatcctggtgtaattggctctgccgagaaagctttaattttatagataac
tctttcagaaaaaaaagatttaaagaatccatttctaaactcgatgaaatcttaagtagc
tcaaaatcaggatttgtagatccatcaatttccaacatgggtgatatagagcctggtgtt
ggagatataatttttattccctatatggagagaatgaatgcatcacttacttattataaa
gggtttaatttaagatctaattatcgtcatgtagataaatggcttaccctttttgagggg
acaagtgcttatagaggcactcaaggagattttcatactcatgctcatgatttaccccca
caaatgggaggatgctataaagaaagcaatgaaaaacagattactttctctaagctaata
gatactggggagggtttaggtaattatgagtttaaccaaaattatgattcaaaatattat
gcaacaattgctcttaaaagagtgataaagcataaagaaaatttactaaaagtaaaccca
tataataaagaatcctttgaggaatcattgagatcagcgctgacccatatgatcaaaggt
gaagtactaatccctaaaaaactttcaggaatctccttaaaatacttaaaaaatagaatc
tcagttccaagagatatgccaataatttcagcaaggttattaagacaatcattaaacaaa
attgaatcgctttgtgatatcaatgaaatagataagatacctttcagacatagatatgat
caagatcctagaaattttatttctagttaa

DBGET integrated database retrieval system