KEGG   Prochlorococcus marinus MIT 9215: P9215_09441Help
Entry
P9215_09441       CDS       T00598                                 

Gene name
gatA
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00970  Aminoacyl-tRNA biosynthesis
pmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    P9215_09441 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pmh03029]
    P9215_09441 (gatA)
Enzymes [BR:pmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     P9215_09441 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     P9215_09441 (gatA)
Mitochondrial biogenesis [BR:pmh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    P9215_09441 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase GldM_N
Motif
Other DBs
NCBI-ProteinID: ABV50559
CyanoBase: P9215_09441
UniProt: A8G4M8
LinkDB All DBs
Position
816062..817510
Genome map
AA seq 482 aa AA seqDB search
MDFNSLRKEIINNNASVKELVNDFFDKIKHKDPEINSYICTTKDNAIEQAENIDKLIQNK
EKLPPLAGIPIAIKDNICTKGVATTCASKMLKSFVPPYESTASSKLWSSGGICLGKTNLD
EFAMGSSTETSLFGVTSNPWDINRVPGGSSGGSAASVAAGFCAAAIGSDTGGSIRQPASF
CGVVGLKPTYGRVSRWGLVAFASSLDQIGPITNTVSDAAEILYSISGKDPFDSTCLDKPV
PNYLNDLNKSINGLKIGIIKECFEHPGLNQEVKESVLSGVDRFKALGAEIIEVECPRFND
GIATYYVIAPSEASANLARYDGVKYGYRSKEGSNLVDMTSKSRAKGFGDEVQRRILIGTY
ALSAGYSDAYYKKAQKVRTLIRKDFDNAFKKVDVLLTPTCPTTAFLKGDYVNDPLSMYLS
DLLTVPVNLAGLPAISIPCGFDTKGLPIGLQLIGNVLEEGKILNAANIFEIDAQVIKNRP
LF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggattttaattctttaagaaaggaaattattaacaataatgcttcggttaaggaatta
gtaaatgatttttttgacaaaatcaaacataaagatcctgaaattaactcatatatttgt
actacaaaggataatgcaattgagcaagcagagaacattgataaattaatccaaaataaa
gaaaaacttcctcctctcgcagggatcccaattgcaattaaggataatatttgcaccaaa
ggagttgctacaacttgtgcgagtaaaatgcttaaaagctttgttccaccttatgaatcc
acagcctcaagtaaattatggtcttcagggggaatttgtttaggaaaaacaaatttagat
gaatttgcaatgggtagttcaacggaaacttctttatttggcgtcacttcaaatccttgg
gatattaatagagtgccaggaggaagttcaggtggtagtgctgcctcagttgctgctgga
ttttgtgcggctgctataggttccgacacgggaggatcaataagacaaccagcttcattt
tgcggtgttgtaggtcttaaaccaacttatggcagagttagcagatggggcctggtagca
tttgctagctctcttgatcaaattggcccgattacaaatactgtctcagatgctgctgaa
attctttattcaatatctggaaaggatccctttgactcaacatgtcttgataaaccagtg
ccaaattatttaaatgatttaaataaatctataaatggtttaaaaattggaatcattaaa
gaatgttttgaacacccaggtcttaatcaagaagttaaggaatctgttctttctggagta
gatagattcaaagctttaggagctgaaattatagaagttgaatgccctagatttaatgat
ggaattgcgacatattatgtcattgcaccatctgaagcttccgcaaatttagctagatat
gacggagttaaatatggctacagatccaaagaaggttcaaatcttgtagatatgacttca
aaaagtagagccaaaggttttggagatgaagttcaaagaagaattttgataggtacctat
gctttgtccgcaggatacagtgatgcctattacaaaaaggcacaaaaagttaggacactt
attagaaaagattttgataatgcttttaagaaagtagatgttttgttaactccaacttgc
ccaaccaccgcttttttgaaaggggattatgtaaatgatccactttcaatgtatttgtct
gatctattaaccgttcccgttaatttagccggactcccagcaataagcattccctgtggt
tttgatactaaaggtttgcctattggattgcaattaataggtaatgtattagaagaaggt
aaaatattgaatgccgcaaatattttcgaaattgatgctcaagtaattaagaacagacct
ttattctaa

DBGET integrated database retrieval system