KEGG   Prochlorococcus marinus MIT 9215: P9215_18471Help
Entry
P9215_18471       CDS       T00598                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
pmh00620  Pyruvate metabolism
pmh00680  Methane metabolism
pmh00710  Carbon fixation in photosynthetic organisms
pmh01100  Metabolic pathways
pmh01120  Microbial metabolism in diverse environments
pmh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P9215_18471 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9215_18471 (ppc)
   00680 Methane metabolism
    P9215_18471 (ppc)
Enzymes [BR:pmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     P9215_18471 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 RdRP
Motif
Other DBs
NCBI-ProteinID: ABV51460
CyanoBase: P9215_18471
UniProt: A8G779
LinkDB All DBs
Position
complement(1584117..1587086)
Genome map
AA seq 989 aa AA seqDB search
MESFRQIKNNNVDLISNNDPLDKNRLLIEDLWESVLREECPDDQAERLIQLKELSYSKQM
NGDSSKTFKNEIVDIVNSMDLAESIAAARAFSLYFQLVNILEQRVEEDRYIQSFTNKDVQ
KSHDNLDPFAPALARQNAPVTFRELFYRLRKLNVPPGKLEELLQEMDIRLVFTAHPTEIV
RHTIRHKQTRVANLLKKIQIEQFLTKEEKNSLKNQLKEEVRLWWRTDELHQFKPSVLDEV
DYALHYFQQVLFNAMPQLRGRIAEALTENYPDVQLPSQSFCNFGSWVGSDRDGNPSVTPE
ITWRTACYQRQLMLERYIIATSNLRDQLSVSMQWSQVSSSLLESLETDRVKFPEIYEARA
TRYRSEPYRLKLSYILEKLRLTQERNNLLSDNGWKFDLEGEIDNKNLDKVENLYYKSVNE
FTYDLELIKNSLISTGLTCESVNTLLTQVHIFGFSLASLDIRQESTRHSDAIQELTNYLD
LTMKYDQMSEEEKIKWLIDELNTKRPLIPSDVNWTKTTEETFSVFKMVKRLQQEFGSRIC
HSYVISMSHSASDLLEVLLLAKEMGLLDQNSQKSKLLVVPLFETVEDLKRAPEVMERLFK
LDFYRSLLPKVGESFKPLQELMLGYSDSNKDSGFVSSNWEIHRAQIALQNLSSRNNILLR
LFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELALYNLETVTT
AVIQNSLVNNRLDATPEWNQLMSRLAETSRSHYRKLVHENPDLLNFFQEVTPIEEISKLQ
ISSRPARRKKGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALSSELNSDPRQIELLRV
LHQRWPFFRMLISKVEMTLSKVDLEVARYYVDTLGSRENKDSFDDIFEVISKEYNLTKSL
ILEITGKNKLLESDRDLKLSVSLRNKTIIPLGFLQVSLLRRLRDQTRQPPISEFIIDKDE
SRRAYSRSELLRGALLTINGIAAGMRNTG
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggaatcttttcgacagataaaaaataataacgtggatcttataagtaacaatgatcca
ctcgataaaaatcgacttttaatagaagatctatgggaatctgtactaagagaagaatgc
ccagatgatcaagcagagagattgatacagcttaaagaattaagttattcaaaacaaatg
aatggtgatagttcaaaaacttttaaaaatgaaatagttgatattgtaaattctatggat
ttagcagaatccattgcagcagcaagggcattctcattgtattttcaactagtgaatatt
ttggaacaaagagttgaggaagatagatatatacaaagctttactaataaggatgttcaa
aaatcgcacgataatctcgatccttttgcaccagcattggctaggcaaaatgctccagta
acttttagagaattattttatagattgaggaaattaaatgtacctccaggaaaattagaa
gagttactgcaggaaatggatatccgtttagtttttactgcacatccgactgagatagta
agacatacgattagacataagcaaacaagagtagccaatttattaaaaaaaatacagatt
gaacaatttctcacaaaagaagaaaaaaattctctaaaaaaccaattaaaagaggaagtt
agactttggtggagaacagatgaattgcatcaatttaaaccatcagttttagatgaagtg
gattatgccttgcattattttcaacaagttttatttaatgcgatgcctcaattaaggggt
aggatcgctgaagcactcactgaaaattatccagatgttcagttgccctctcaatctttt
tgtaacttcggttcttgggtaggttctgatagggacggtaatccatcggtcactcctgag
ataacatggagaactgcttgctaccaaaggcagttgatgttggaaagatatattattgcg
acatcaaatcttagagatcaattaagtgtctcgatgcaatggagtcaagttagttcttct
ctattagagtcacttgaaacggacagggttaagttcccagaaatctatgaagctagagct
accaggtatagatcagaaccttacagattgaagttaagttatattttagaaaaattaagg
ttaacccaagagagaaataatttattatctgataatgggtggaaatttgatttagaggga
gaaattgataataaaaatttagataaagttgaaaacttatattataagtctgttaacgaa
tttacttatgatctcgaattaattaaaaatagcctgattagtacaggtttaacttgcgag
tctgtaaacaccttacttactcaggttcatatttttggattttctttggcaagtttagat
attcgtcaagagagtacaagacatagtgacgcaatacaagaacttacaaattatcttgat
ttaactatgaaatatgaccaaatgtctgaggaggagaaaattaaatggcttatagatgaa
ttaaatacaaaaaggcctcttattccatctgacgttaactggacaaaaactacagaagaa
accttttcggtttttaaaatggttaagagactacagcaagaatttggaagtcgcatatgt
cattcttatgtgatttcaatgagtcatagtgcatctgatttgcttgaagttcttttactg
gcaaaagaaatgggacttctggatcaaaattcacaaaagtcaaaattattagttgttcct
ctttttgaaactgtagaagaccttaaaagagcacccgaagtaatggaaaggttgtttaaa
ttagatttctatagatccttattgccaaaagtgggagaatcttttaaacctctgcaagaa
ttaatgcttggatattctgatagcaataaagattcgggatttgtttctagtaattgggaa
attcatagagcccaaatagctcttcaaaatctttcaagtagaaataatatattgttaaga
ctttttcatggaagaggtggttctgtagggagaggaggaggaccagcctatcaggcaata
ttggcccaaccaagcggcactttaaaaggacgaataaaaataacagaacaaggtgaggtt
ttagcttctaaatatagtcttcccgaactggctttatacaatcttgagactgtcactaca
gcggtaattcaaaatagtttggtaaataatagacttgacgctaccccagaatggaatcaa
ttaatgtctaggttggcagaaacgtcaaggtctcactatagaaaattagtgcatgagaat
cctgatttattaaatttctttcaagaggtcactccaatagaagaaataagtaaattacag
atatctagtaggcctgctagaagaaaaaaaggtgcaaaagatttgtcaagtttaagagct
attccatgggtatttggttggacacaaagtagatttcttttgccaagttggtttggagtg
ggtactgcattgtcatctgaattaaattctgatccacgacaaattgaattattaagagtt
ttacatcaaagatggccattttttaggatgcttatatctaaggtagaaatgacattatct
aaggtggatttggaagttgccagatattatgttgatactcttggaagtagggaaaataaa
gattcttttgatgatatttttgaagtaatttccaaagaatataatcttacaaaatcttta
attcttgaaattactggaaaaaataagctcctcgaatctgatagagacttgaaattatct
gtaagcttgaggaataagacaatcattccgttggggtttttgcaggtttcacttttaaga
agattaagagaccagacaagacaacccccaataagcgaatttattattgataaagatgaa
tctagaagagcttacagtagaagtgaactattgaggggggcacttttaactatcaatgga
atagcagctggcatgagaaatacaggttga

DBGET integrated database retrieval system