KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0400
Entry
PMT9312_0400      CDS       T00297                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00010  Glycolysis / Gluconeogenesis
pmi00020  Citrate cycle (TCA cycle)
pmi00620  Pyruvate metabolism
pmi01100  Metabolic pathways
pmi01110  Biosynthesis of secondary metabolites
pmi01120  Microbial metabolism in diverse environments
pmi01200  Carbon metabolism
Module
pmi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMT9312_0400
   00020 Citrate cycle (TCA cycle)
    PMT9312_0400
   00620 Pyruvate metabolism
    PMT9312_0400
Enzymes [BR:pmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PMT9312_0400
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding CDC73_N MadL
Other DBs
NCBI-ProteinID: ABB49461
CYORF: PMT9312_0400
UniProt: Q31CD4
LinkDB
Position
379566..380933
AA seq 455 aa
MSHEIFMPALSSTMTEGKIVEWLKNPGDKVERGESVLVVESDKADMDVESFQDGYLAAVL
MPAGSTAPVGETIGLIVENEDEIASVKEQNKGNQPEVSSSDKLELVSNKTEEKPEVHNEN
VKKEEKEVVLKSEKSAPSFNSDQINAATSNVSSRVIASPRAKKLASQMGVDLAKVHGSGP
HGRIQADDILKANGQPVSIPWIGEGSSPASIPGANLQVESKPETSGNSFGNPGETVQFNT
LQKAVNKNMESSLDIPCFRVGYSINTDKLDNFYKKVKQNGVTMTALLVKAVAKTIKKHPQ
VNSSFSENGISYPENINIAVAVAMEDGGLITPVLKEPCNTDLFELSREWKDLVKRSRSKQ
LEPDEYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAIASSKPTVVANSDGSISVKKIMQ
VNLTADHRVIYGADGASFLKDLASLIENEPETLVS
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtctcacgaaatattcatgcctgccttgagttctaccatgacagagggcaagattgtg
gaatggttgaaaaatcctggagataaggttgaaaggggtgaatctgtcctagttgttgaa
tctgataaggcagatatggatgttgaatcttttcaagatggatatcttgcagcagtttta
atgcctgctggtagcactgcaccagtaggggaaactataggtcttattgtagaaaatgag
gatgagatagcttctgttaaagaacaaaataaaggaaatcaacccgaagtttctagttcg
gataaacttgaattggtaagcaataaaaccgaagaaaaaccggaagtacataatgaaaat
gttaaaaaagaagaaaaagaagtcgtcttaaagagtgaaaagtcagccccatcttttaat
agtgatcaaattaatgctgctacaagtaatgtttcttcaagggtaattgcatctccaaga
gctaaaaaacttgcctctcaaatgggtgttgacttagcaaaagttcacggatctggacct
cacggaagaattcaagcagatgatattttaaaagctaatggtcaacctgtatctattcca
tggataggagagggtagttctcctgcaagtattcctggtgcaaatttacaagttgaaagt
aaaccagaaacatcaggaaatagttttggtaatcctggagaaacagtgcaatttaatact
cttcaaaaagcggtaaataaaaatatggagtctagtttggatattccatgttttagggtg
ggatactctataaacacagataaattagataatttctacaaaaaggtaaaacaaaatgga
gtcactatgactgctttactagtaaaggcagttgcaaagacaattaagaaacatcctcaa
gttaactcaagtttttcagaaaatggaatttcttatccagaaaatattaatattgctgtt
gccgtcgcaatggaagatggcggattaataactccagttttaaaagaaccttgcaatact
gatttatttgaattatctagggaatggaaagatttggtaaaaagatcaagatcaaaacaa
ttagaacctgatgagtactcaacaggaacctttactttatctaaccttggtatgtttgga
gttgatagatttgacgcaattctacccccaggtactggtgctattttagcgatagcatca
tcgaaaccaactgttgttgctaatagtgatggctcaatatctgttaaaaaaattatgcaa
gtaaatctaaccgctgatcacagagtgatctatggagctgatggtgcttcattcttaaaa
gatttggcttccctgatagaaaatgagccagagacacttgtatcttaa

DBGET integrated database retrieval system