KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0550Help
Entry
PMT9312_0550      CDS       T00297                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00630  Glyoxylate and dicarboxylate metabolism
pmi00710  Carbon fixation in photosynthetic organisms
pmi01100  Metabolic pathways
pmi01120  Microbial metabolism in diverse environments
pmi01200  Carbon metabolism
Module
pmi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PMT9312_0550
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMT9312_0550
Enzymes [BR:pmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PMT9312_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABB49611
CYORF: PMT9312_0550
UniProt: Q31BY4
LinkDB All DBs
Position
513733..515148
Genome map
AA seq 471 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPEYVPLDTDLLACFKCTGQEGVPREEVAAAVAAESSTGTWST
VWSELLTDLEFYKGRCYRIEDVPGDPEAFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDRLNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQETGEVKGHYLNCTANTPE
ELYERAEFAKELDMPIIMHDYITGGFTANTGLANWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDNLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAAKHSPELAIALETWKEIKFEFDTVDKLDVQG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaagtatgatgcaggggtaaaggagtacagagatacctactggactcctgaa
tatgtacccctagacaccgatttactagcctgtttcaaatgtacaggtcaagaaggtgtt
ccaagagaagaagttgcagcagctgttgcagcggaatcttcaacaggtacttggtcaaca
gtttggtccgagttacttacagacttagaattttataaaggacgttgttatcgaattgaa
gacgttccaggagatcctgaagctttttatgcttttatcgcatatcctctagatcttttt
gaagaaggttcaattacaaacgtattaacatctctagtaggaaacgtttttggatttaaa
gctctaagacatttacgtcttgaagatattagattcccaattgctttcatcaaaacttgc
ggtggtccaccaaatggaatcgtagttgaaagagatcgtttaaacaaatacggaagacct
cttcttggttgtaccattaaacctaaattaggcttatctggtaaaaactatggtcgagtt
gtatatgaatgtcttagaggcggtcttgatttaacgaaggatgacgagaatattaattct
caaccattccagcgttggagagaaagatttgagtttgttgcagaagcagttaagctcgct
cagcaagaaactggagaagttaaaggtcactacctaaactgtactgctaacactcctgaa
gaactttatgaacgagctgaatttgcaaaagagctagatatgccaatcatcatgcatgat
tatataactggtggttttactgcaaatactggattagcaaactggtgtcgtaaaaatggc
atgcttctgcacattcatagagctatgcatgctgttattgatagacatccaaagcatggt
attcatttcagagttctagcaaaatgtttgagactctccggaggagatcaattgcatact
ggaactgttgttggaaaactagaaggtgatcgtcaaacaactcttggctacattgacaac
ttaagagagtcatttgttcctgaagatagatcaagaggtaacttctttgatcaagattgg
ggttcaatgccaggagtatttgctgtcgcatcaggtggtattcacgtatggcatatgcct
gcacttttagcgatttttggagatgattcttgtcttcagttcggtggaggaacacatggc
catccatggggttcagctgctggagctgcagccaacagagttgctttagaagcttgtgta
aaagcacgtaatgcgggtcgcgaaatcgaaaaagagagtagagacattcttatggaagct
gctaagcatagtcctgaattagctattgctctcgaaacttggaaggaaatcaagtttgag
tttgataccgtcgacaagcttgacgttcaaggttaa

DBGET integrated database retrieval system