KEGG   Prochlorococcus marinus MIT 9312: PMT9312_0566Help
Entry
PMT9312_0566      CDS       T00297                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pmi  Prochlorococcus marinus MIT 9312
Pathway
pmi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PMT9312_0566
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmi02000]
    PMT9312_0566
Enzymes [BR:pmi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PMT9312_0566
Transporters [BR:pmi02000]
 Other Transporters
  Pores ion channels [TC:1]
   PMT9312_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N_4 GST_N Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ABB49627
CYORF: PMT9312_0566
UniProt: Q31BW8
LinkDB All DBs
Position
complement(527726..528952)
Genome map
AA seq 408 aa AA seqDB search
MNDILTWEDLNKYKVEDLDRVNGINNSYANLRLFGHTANDVIITLYRDRHSWCPYCQKIW
LWLEYKRIPYRVKKINMFCYGKKESWFLHKVKSGKLPAIEFKGQFITESDDIISFLENEF
GALGSFITSSHLIKTRELEREIFRSWCNWLCRESFNFIDNSFRKKRFKESISKFDEILRK
SKSGFVDPSASNTGEIEPGVGDIIFIPYMERMNASLTYYKGFNLRSNYRYVDNWLTLFEE
TSTYRGTQGDFHTHSHDLPPQMGGCYKESNEQQIALSELIDNGKGLGNYELNKNYDSKYF
AKIALKRVIKHKDSLIKVNPYDKESFDESLRSALTHMITGEIRITEKLSGISIKYLKNRI
SVPRDMPLISARLLRQSLNKIELLSDKNEIDKIPLMHRYDQDPRNFIL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatattttgacatgggaagatttaaataaatataaagttgaagatcttgataga
gtcaatggtattaataattcctatgcaaatttaagattatttgggcatactgcaaatgat
gtaataattaccctctatagggataggcattcttggtgtccttactgtcagaaaatatgg
ttatggcttgaatataaaagaattccgtacagagtcaaaaaaataaacatgttttgttac
ggtaaaaaagaaagttggttccttcataaagttaaatcaggtaaattacctgcaattgaa
ttcaaagggcaatttataacggaaagcgatgatatcatatcttttttagaaaatgaattt
ggagcacttggttcctttataacatctagtcaccttattaaaactcgagaattagaaaga
gaaattttcagatcctggtgtaattggctttgccgagaaagctttaattttatagataat
tcttttagaaaaaaaagatttaaagaatcaatttctaaatttgatgaaatcttgagaaaa
tcaaaatcagggtttgttgatccatcagcatcaaatacaggtgaaattgagcctggtgtt
ggagatataatttttattccttatatggagagaatgaatgcttcattaacttattataaa
ggatttaatttaagatctaattaccgttatgtagataactggcttaccctttttgaagag
acaagtacttatagaggcactcaaggagattttcatactcactctcatgatttacctcca
caaatgggtggatgttataaagaaagcaatgaacaacagatagcgttatctgagttaata
gataacgggaaaggtcttgggaattatgaattaaataaaaattatgattcaaaatatttc
gcgaaaattgctcttaaaagagtaataaagcataaagacagtttaataaaagtaaaccca
tacgataaagaatcctttgatgaatcattgagatcagctttgacacacatgatcacaggt
gaaattcgtataactgagaaactttcaggaatatctataaaatacttaaaaaatagaatc
tcagttccaagagatatgccacttatttccgcaaggttattaagacaatcattgaataaa
attgaattgctaagtgacaaaaatgaaatcgataagatacctcttatgcatagatatgat
caagatcctagaaattttattttatag

DBGET integrated database retrieval system