KEGG   Proteus mirabilis BB2000: BB2000_0807
Entry
BB2000_0807       CDS       T02789                                 

Gene name
tssO
Definition
(GenBank) TssO
  KO
K11911  type VI secretion system protein VasL
Organism
pmib  Proteus mirabilis BB2000
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmib02044]
    BB2000_0807 (tssO)
Secretion system [BR:pmib02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BB2000_0807 (tssO)
SSDB
Motif
Pfam: VasL ImpA_N IZUMO
Other DBs
NCBI-ProteinID: AGS59303
LinkDB
Position
complement(918878..920233)
AA seq 451 aa
MLSAMKSESLVIKIGGSPLDTPEFIALKTEFNKLSHPARPEISWTLIESLCLSLFKNHGI
DLQSGAYYTIARLQQHGLSGFTEGCELLANVIVTYWDSLWPEKPNQRTEVLNWFNTKASA
LLRQQSYQAKDLRLIYRSERALQLIIDKLAKTTWEKLPKIENLLWFFQNLAKQIEKQEKQ
TQQDSAEPVSVPPLVCIQQPSKTTDKAAPTFVIETPQPASSFTVVAKKMSATRGFIWGCV
LSCILFLAVGFGVHLYLKQEMNAITSIPEGAAAKWLFKPQLNSYEYHLALLEKRSPLSNL
RLIDTMQEKAKNAWPTDAEQIYFTRNWQNLYQTRLENMPINDSWSETATLLQQLSNKIVQ
QERNRGSFTLSYLKTAIYDIQKQHNKVEPIEEKLRQLAVQIETGQPISPATFNNIDNKIN
GLLARYYDLQKQAEQQGLKPGSYSSFGLDHE
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgttgagtgcgatgaaatcagaaagtttagtgattaaaattgggggatctccacttgat
acccctgaatttattgccctgaaaaccgaatttaataaattgagccaccctgctcgacca
gaaataagttggacacttattgagtcactttgcttatccctatttaaaaatcatggtatc
gacctacaaagcggtgcttactataccattgcaagattacaacagcatggtttaagcggt
tttactgaaggatgtgagttattagcaaatgttattgtgacttattgggatagcctgtgg
ccggaaaagccaaaccaacgtacagaggtattaaactggtttaataccaaagccagcgct
ttattaagacaacaatcctatcaagcaaaagatctacgattaatctatcgttcagagcgc
gcgttacagttaataatcgataaactggctaaaacaacttgggaaaaactgcctaaaatt
gaaaacttactgtggtttttccaaaacttagccaaacaaattgaaaaacaagaaaaacag
acgcaacaagatagtgccgaacccgttagcgtaccgccattagtctgtattcaacaaccg
tcgaaaacaacggacaaagcagcccccacttttgtgattgaaacgcctcaacccgcctct
tctttcactgtagtagcaaaaaaaatgagtgcgacccgaggttttatatggggctgtgtg
ctcagttgcatactgtttttagctgtcggatttggtgtacatctctatttaaaacaagag
atgaatgcgattacttcaatacctgaaggtgcggctgctaaatggttgtttaaaccacag
ttaaatagctacgaatatcatttagcattattagaaaaacgttctcccctttctaattta
cggctaattgatacgatgcaagaaaaagccaaaaacgcttggcctacagatgcagagcaa
atttattttacacgtaattggcaaaatctttatcaaactcgcttagagaatatgccaatt
aatgatagctggtctgaaaccgcgacattattacaacaactttctaataaaatagttcag
caagaacgaaatagaggcagttttacactctcttatctaaaaacggcaatttatgatatt
caaaaacagcacaataaagttgagccaatcgaagaaaaactgcgacagctcgctgtacaa
attgaaacagggcaacctatttctcctgcaacttttaataatattgataataaaattaat
gggttattagctcgttattatgatttacaaaaacaagctgaacaacaaggtttaaaacca
ggctcatattcatcttttggattagatcatgagtga

DBGET integrated database retrieval system