KEGG   Proteus mirabilis BB2000: BB2000_1086Help
Entry
BB2000_1086       CDS       T02789                                 

Definition
(GenBank) hypothetical protein
  KO
K12963  undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF
Organism
pmib  Proteus mirabilis BB2000
Pathway
pmib01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BB2000_1086
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pmib01005]
    BB2000_1086
Lipopolysaccharide biosynthesis proteins [BR:pmib01005]
 Unusual sugar
  BB2000_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA Multi_Drug_Res TMEM234 Voltage_CLC
Motif
Other DBs
NCBI-ProteinID: AGS59580
LinkDB All DBs
Position
1206656..1207057
Genome map
AA seq 133 aa AA seqDB search
MKTGYLWAIASALLVTVAQLLLKIGMSELPDLQLEKQWFDLHWLWANIIPISVVFVGLIG
YVLSMVCWLLTLRTIPLNKAYPLISLSYVFVYILAVVLPWFQETLSWSKTIGIIFIMLGV
WLISQKTEQTTSH
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccggttacttatgggccatcgccagcgcattattagtcacagttgcacaacta
ctgttaaaaataggtatgtcagaattacctgatctgcaattagaaaaacagtggtttgat
cttcattggttatgggcaaacataatacctatcagcgttgttttcgtgggactgattggc
tacgtactgtcaatggtttgttggttattgactttacgtacaatccccctaaacaaagct
tatccactcatcagccttagctatgtctttgtttatattctcgcggtggttttaccttgg
tttcaagaaacgctgtcgtggtctaaaacaataggtatcatttttattatgctaggtgtt
tggttaataagccaaaaaacggagcaaacaacatcgcattag

DBGET integrated database retrieval system