KEGG   Proteus mirabilis BB2000: BB2000_1220Help
Entry
BB2000_1220       CDS       T02789                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pmib  Proteus mirabilis BB2000
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BB2000_1220 (ahpF)
Enzymes [BR:pmib01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BB2000_1220 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored Thi4 FAD_binding_3 DAO AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGS59713
LinkDB All DBs
Position
1350798..1352363
Genome map
AA seq 521 aa AA seqDB search
MLDNNLKAQLKAYLERLTQPVELVATLDDSKHSADIQALLKEIEPLSDKVTYREDNSANV
RKPSFLITNPGKTTGVRFAGSPLGHEFTSLVLALLQTGGHPSKEAPELLEQIRQLDGEFH
FETYYSLSCHNCPDVVQALNLMAILNPNITHTAIDGGMFQNEIQERNIMGVPAVFLNGNE
FGQGRMTLAEIVSKVDSNAEKRTAELLNKKDAFDVLIVGSGPAGASAAVYAARKGLNTGL
IGERFGGQVLDTVDIENYISVPKTEGAKLAGALKAHVDDYQVDVIDSQTVSRLIPGAAEG
DLHQIETASGAILKTRSLIIATGARWRNMNVPGENEYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTVLEFASEMRADAVLQKKLRSLSNVDVILNAQTTEVYGD
GTKLTGLKYKDRTNDSMHDIALAGIFVQIGLLPNTQWLEGTVERNKIGEIVVDPRGETNI
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTTAK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagataataatttaaaagctcaactgaaagcttacctagaacgattaacccagcca
gttgagttagttgcaacattagacgacagcaaacattctgctgatatccaagccttatta
aaagaaattgaaccgttatctgataaagtcacataccgtgaagataacagtgctaatgtg
cgcaaaccatcttttcttattaccaacccagggaaaacaactggcgttcgttttgcaggc
tcgccattaggtcatgagtttacttctttagtattagcattattacaaaccggtggtcat
ccatctaaagaagccccagaattacttgaacaaattcgtcagttagacggtgagtttcat
ttcgaaacctattattcgctctcttgtcataactgccctgatgttgttcaggcattaaac
ttaatggcgattttaaatccgaacatcacccatacggcgattgacggaggcatgttccaa
aatgaaattcaggaacgtaatatcatgggcgttcctgcggtattcttaaatggcaacgag
tttggccaaggtcgaatgactttagctgaaattgttagcaaagtagatagcaatgcagaa
aaacgcactgcagagttattaaataaaaaagatgcctttgatgttctgattgtcggaagc
ggccctgcaggggcgtcagcggcagtatatgctgcacgtaaaggcttaaatacaggtctt
atcggtgaacgttttggtggacaagttcttgatactgttgatattgaaaactatatctct
gtacctaaaacagaaggtgcaaaattagcaggggctttaaaagcacacgttgatgattat
caagttgatgtcattgacagccaaactgtcagccgtttaattccgggagcagcggaaggt
gatctacaccaaattgaaaccgcatctggtgcgattttaaaaacccgtagcttaattatt
gccacgggtgctcgctggagaaatatgaacgtaccgggtgaaaacgagtaccgtactcgc
ggtgtaacatactgcccacattgtgatggtcctctatttaaaggtaaaagagtggctgtt
attggtggtggtaactccggtgttgaagctgccattgacttagctggtttagtggagcac
gtgaccgtactagaatttgcctcagaaatgagagccgatgctgttttacaaaagaaactg
cgtagcttaagtaatgtcgatgttatcttaaatgctcaaacaacagaagtatatggagat
ggcactaagttaacaggactgaaatataaagatcgcactaacgattcaatgcatgatatt
gccttagcgggtatttttgtccaaattggtttactgccaaacacacaatggttagaagga
actgttgagcgtaataaaattggtgagatcgtggttgatccacgtggtgaaaccaatatt
aaaggggtatttgctgcgggtgactgcacaactgttccttataaacaaattattatcgcc
gcgggtgaaggtgcaaaagcctcattaagcgcctttgattacttaattcgtacgactgca
aaataa

DBGET integrated database retrieval system