KEGG   Proteus mirabilis BB2000: BB2000_1435Help
Entry
BB2000_1435       CDS       T02789                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pmib  Proteus mirabilis BB2000
Pathway
pmib00250  Alanine, aspartate and glutamate metabolism
pmib00410  beta-Alanine metabolism
pmib00430  Taurine and hypotaurine metabolism
pmib00650  Butanoate metabolism
pmib01100  Metabolic pathways
pmib01110  Biosynthesis of secondary metabolites
pmib01120  Microbial metabolism in diverse environments
pmib02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BB2000_1435 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BB2000_1435 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB2000_1435 (gadB)
   00430 Taurine and hypotaurine metabolism
    BB2000_1435 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB2000_1435 (gadB)
Enzymes [BR:pmib01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BB2000_1435 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGS59926
LinkDB All DBs
Position
complement(1569221..1570612)
Genome map
AA seq 463 aa AA seqDB search
MNKKTPSYSSLDDVYASVDLSQSLPKTHFPQQESHPRHVFDAVRDELMLDGNSRQNLATF
CQTWVDDEIRDLMNLSIDKNMIDKDEYPQTAEIENRCVHMLADLWHSPDPLNTLGCSTIG
SSEAAMLGGLALKWQWRKKRLAAGKATDKPNLICGPVQVCWHKFARYFDVELREIPLEGD
RLMMSPEEVIKRVDENTIGVVPTLGVTFTCTYEPVKAVHDALDQLQKETGLDIPIHVDGA
SGGFLAPFCAPDLEWDFRLPRVKSINSSGHKFGLAPLGSGWVVWREAKDLPEELIFNVNY
LGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIHNACYHTAQYLAREIEKLGPFEM
IFSGDSQKGIPALAWKLKKEAKVSYSLYDIADKLRSRGWQVPAYSMPADRQDLVIQRILV
RHGVSLDLATLLIEDMKRTLDYFEKHPVSTPLSEEDGGGFNHS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaacgccaagttatagctcactcgatgatgtttatgcatcggttgattta
tcacaatccttaccgaaaacacactttccgcaacaagagagccatcctcgtcatgttttt
gatgctgtaagggatgagctgatgctagatggcaattcaagacaaaatctggccacattt
tgtcaaacctgggtagatgatgagatccgtgatttaatgaatttatctatcgataaaaac
atgatagataaagatgaatatccacaaacggcagaaattgaaaaccgttgtgttcatatg
cttgctgatttatggcactcacccgatccactcaatactctaggttgttcaactattgga
tcctctgaagcggcaatgctggggggacttgcattaaaatggcaatggcgtaaaaaacgc
cttgctgctggaaaagcgacagataaacctaatcttatttgtgggccagttcaagtttgt
tggcataaatttgcccgttattttgacgttgaactcagagagatcccgcttgaaggtgat
cgcttgatgatgagtccagaagaggtcattaaacgtgttgatgaaaatactatcggtgta
gtgccaacattaggggtgaccttcacctgtacttatgagccagtaaaagcggtacatgat
gcactcgatcaactacaaaaagagaccggacttgatattcctattcatgttgatggtgcg
agtggtggctttttagcgcctttctgtgcacctgatttagaatgggatttccgtttacca
cgagttaaatccattaactcatcaggccataagtttggtttagcgccattgggctctggt
tgggtagtatggcgtgaagctaaagacttaccggaagagcttatttttaatgtgaactac
cttggcggtaatatgccaacctttgcgcttaatttctcacgtcccggtgggcaaattatt
gctcaatactataatttcttgcgtcttggtagagaagggtatgcgaagatccacaatgcc
tgttatcacaccgcgcaataccttgctcgagaaattgaaaagctagggccttttgaaatg
atcttcagtggtgatagtcaaaaaggaatacctgcattagcgtggaaactgaaaaaagag
gctaaggtaagctactccttatatgacatcgctgataaattgcgtagccgtggctggcaa
gtacccgcttattctatgcctgctgatcgccaagatttagttattcaacgtattcttgtt
cgtcatggtgtgagtttagatttggcgacattactgatagaagatatgaaacgtactctc
gattatttcgaaaaacatcctgtcagcacacctttatctgaagaggacggcggtggtttt
aaccacagctaa

DBGET integrated database retrieval system