KEGG   Proteus mirabilis BB2000: BB2000_1881Help
Entry
BB2000_1881       CDS       T02789                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pmib  Proteus mirabilis BB2000
Pathway
pmib00473  D-Alanine metabolism
pmib01100  Metabolic pathways
pmib01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BB2000_1881
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BB2000_1881
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmib01011]
    BB2000_1881
Enzymes [BR:pmib01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BB2000_1881
Peptidoglycan biosynthesis and degradation proteins [BR:pmib01011]
 Precursor biosynthesis
  Racemase
   BB2000_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Peptidase_U32_C Spherulin4
Motif
Other DBs
NCBI-ProteinID: AGS60356
LinkDB All DBs
Structure
PDB: 

Position
complement(2030800..2032023)
Genome map
AA seq 407 aa AA seqDB search
MSLGIRYLALLPLFVITACQQPVNYNPPATQVAQVQPAIVNNSWIEISRSALDFNVKKVQ
SLLGKQSSLCAVLKGDAYGHDLSLVAPIMIENNVQCIGVTNNQELKEVRDLGFKGRLMRV
RNATEQEMAQATNYNVEELIGDLDMAKRLDAIAKQQNKVIAIHLALNSGGMSRNGLEVDN
KSGLEKAKQISQLANLKVVGIMSHYPEEDANKVREDLARFKQQSQKVLEVMGLERNNVTL
HMANTFATITVPESWLDMVRVGGIFYGDTIASTDYKRVMTFKSNIASINYYPKGNTVGYD
RTYTLKRDSVLANIPVGYADGYRRVFSNAGHALIAGQRVPVLGKTSMNTVMVDITSLNNI
KPGDEVVFFGKQGNSEITAEEIEDISGALFTEMSILWGATNQRVLVD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaggtattcgatatcttgcgttattaccacttttcgttattactgcttgccaa
cagcctgtaaattataatccaccagcaactcaagtggctcaagttcagcctgctattgtc
aataattcatggattgaaatttcacgaagtgcactcgactttaatgtaaaaaaagtccaa
tcattattaggtaagcaatcctctctttgtgcggtgttaaaaggagatgcttatgggcat
gatttatcgttagttgccccaattatgatagaaaataatgtgcaatgtattggtgtaaca
aataaccaagaattaaaagaagtacgtgatttaggatttaaaggccgtttaatgcgagtg
cgtaatgcaacagaacaagaaatggcacaggcaaccaactataacgtagaagagttaatt
ggtgatcttgatatggcaaaaagattagatgctattgccaagcaacaaaataaagtcatt
gctattcatttagcattaaattcaggtggcatgtctcgtaatggtttagaggtcgataat
aaatctgggcttgaaaaagcaaaacaaatttctcaattagctaacctaaaagtggttggt
attatgtctcattatcccgaagaggatgctaataaagtaagggaagatctggctcgtttt
aagcaacaatctcagaaagtgttggaggtgatgggattagagcgtaacaatgtcacatta
catatggcaaatacctttgcgacaattaccgtgcctgagtcatggctggatatggtacgt
gtgggaggtattttttatggtgataccattgcgagtacagactataaacgtgtgatgacc
tttaaatccaacattgcttcaattaattattatcctaaaggtaatacggttggctatgat
cgtacttacacattaaaacgtgactcagtactagccaatattcctgtaggttatgcagat
ggttatcgtcgcgtttttagtaatgcggggcatgcgttaattgctgggcaacgtgtacct
gttttaggaaaaacatcaatgaataccgttatggttgatattaccagtcttaacaatatc
aaaccaggtgatgaagttgtattttttggcaaacaaggtaatagcgaaattaccgcagaa
gaaattgaagatatcagtggtgcattgtttaccgaaatgtcaattttatggggagcaacc
aatcaacgggtattagttgattaa

DBGET integrated database retrieval system