KEGG   Proteus mirabilis BB2000: BB2000_2940Help
Entry
BB2000_2940       CDS       T02789                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pmib  Proteus mirabilis BB2000
Pathway
pmib00564  Glycerophospholipid metabolism
pmib01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BB2000_2940 (glpD)
Enzymes [BR:pmib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BB2000_2940 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 3HCDH_N GIDA Mqo FAD_oxidored Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGS61388
LinkDB All DBs
Position
3204504..3205997
Genome map
AA seq 497 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLASATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLRLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRVSLPSS
KSIKFGANSVLKPELIRGFEYSDCWVDDARLVVLNAQEIVRRGGEVRTRTKVTRAWREND
LWMVEAQDLRTGETSRYQAKALVNAAGPWVKTLFDEGLKLKSPYGIRLIKGSHIVIPRAH
DEPQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKDVAIDNNEVEYLLKVYNDHF
KKQLTKDDIVWNYSGVRPLCDDESDSPQAITRDYTLDVHDDNGKTPLLSVFGGKLTTYRK
LGEHAVDKLNAYFPNMGQAWTKEGQLPGGNLEGYDRDGYSRLIRQRHPWLPEALALRFAR
TYGSNTEVLLEGITDLAGMGENFGHNLYEAELRYLVKHEWVIELDDAIWRRTKLGMWLND
EQKQRITQWLEANTHTA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagacttgattgtcatcggcggcggaataaacggcgctggaattgcggcg
gatgcagcaggccgaggcctttcagtattaatgctggaagctcaagacttagccagtgca
acatcttccgctagctcaaaattaattcatggtggcttacgctatttagagcattacgaa
ttccgtttagtcagtgaagcattggctgaacgtgaagttttattgcgtttggcgcctcat
atcgcatttccgatgcgtttccgtttaccgcatcaaccccatctacgcccagcatggatg
atccgcattggtttattcctctatgatcacctaggcaaacgtgtcagtttaccgagcagt
aaaagtattaaattcggggctaactctgtcttaaaacctgaattaattcgtggttttgaa
tattccgactgttgggtagatgatgctcgtttagtagtattaaatgcgcaagagatcgtt
cgtcgtggcggtgaagttcgtactcgtaccaaagtgacacgcgcttggcgtgaaaacgat
ttatggatggtggaagcacaagatttacgcaccggtgaaacttctcgctatcaagcaaaa
gcattagtgaatgcagccggtccttgggttaaaacattattcgatgaagggttaaaatta
aaatcaccttatggtattcgcttaatcaaaggtagccatattgtgatcccacgagctcac
gatgaaccccaagcctatatcttacaaaatgaagataaccgcattgtattcgtgatccct
tggatggatgagttctctattattggtaccactgatgttgaatacaaaggtgatccaaaa
gatgtggctattgataacaatgaagttgagtacttattaaaagtctataacgaccacttt
aagaaacaactgaccaaagacgatatcgtctggaattattcaggggtgcgtccattatgt
gatgacgaatccgattcgccacaagctatcactcgtgactataccttagatgtacatgat
gataatggtaaaacaccactactctctgtatttggtggtaaattaacgacttatcgtaaa
ctcggtgaacacgcggttgataagctaaatgcttatttccctaatatgggtcaagcgtgg
acaaaagagggtcaattaccgggggggaacttagaaggttacgatcgtgatggctattca
cgtcttattcgccaacgtcatccttggttaccagaagcattagcactacgttttgctcgc
acttatggtagcaatactgaagtgttgctagaaggtattactgatttagccggaatgggc
gaaaatttcggtcataatctttacgaagctgaattacgttatttagttaaacatgagtgg
gtgattgagcttgatgatgctatttggcgtcgtaccaaacttggcatgtggcttaatgat
gaacaaaaacaacgtattacgcaatggttagaggcaaatacgcacacagcataa

DBGET integrated database retrieval system