KEGG   Proteus mirabilis BB2000: BB2000_3552Help
Entry
BB2000_3552       CDS       T02789                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pmib  Proteus mirabilis BB2000
Pathway
pmib00071  Fatty acid degradation
pmib00280  Valine, leucine and isoleucine degradation
pmib00281  Geraniol degradation
pmib00310  Lysine degradation
pmib00362  Benzoate degradation
pmib00380  Tryptophan metabolism
pmib00410  beta-Alanine metabolism
pmib00640  Propanoate metabolism
pmib00650  Butanoate metabolism
pmib00903  Limonene and pinene degradation
pmib00930  Caprolactam degradation
pmib01100  Metabolic pathways
pmib01110  Biosynthesis of secondary metabolites
pmib01120  Microbial metabolism in diverse environments
pmib01130  Biosynthesis of antibiotics
pmib01200  Carbon metabolism
pmib01212  Fatty acid metabolism
Module
pmib_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BB2000_3552 (fadB)
   00650 Butanoate metabolism
    BB2000_3552 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BB2000_3552 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BB2000_3552 (fadB)
   00310 Lysine degradation
    BB2000_3552 (fadB)
   00380 Tryptophan metabolism
    BB2000_3552 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB2000_3552 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BB2000_3552 (fadB)
   00281 Geraniol degradation
    BB2000_3552 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BB2000_3552 (fadB)
   00930 Caprolactam degradation
    BB2000_3552 (fadB)
Enzymes [BR:pmib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BB2000_3552 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BB2000_3552 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BB2000_3552 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     BB2000_3552 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGS61969
LinkDB All DBs
Position
complement(3834594..3836774)
Genome map
AA seq 726 aa AA seqDB search
MLYQSENIQADWVKQGIVELVFNASGSINKLDTKTVAMLSEALTVLENTSDLKGVILRSE
KPAFIVGADITEFLSLFDAPVEELTQWLHFANHIFNRLEDLPVPTVSAINGYALGGGCEC
VLATDFRIASPDLRIGLPETKLGIMPGFGGSVRLPRLIGVDNALEIITAGKDINAETALK
NGLIQAIVPVDKLKESAISLIEQAIDGKFDWQAARQPKTVALRLTELEHKMSFAVAKGMV
MKVAGPHYPAPMTAVNTIEKAAFLDRKAALELETENFVKLTRTDVAKALVGIFLNDQYVK
GITKKRHASLPKQAAVLGAGIMGGGIAYQSALKGIPVTMKDINANSLELGMTEALSLLQK
RQEKGRMSAVDMAKTLASIHPTLNYASVADAQIVVEAVVENPKVKASVLAETEALLADHA
VLASNTSTIPISLLAKSLTRPENFCGMHFFNPVHRMPLVEIIKGEKTSEETINRIVSYAS
KMGKTPIIVNDCPGFFVNRVLFPYFAGFSLLLRDGADFIAVDKVMEKAFGWPMGPAYLLD
VVGIDTANHAQAVMAQGFPDRMGSIDKDVIALLYQQQRYGQKNNHGFYDYTIDKRGKKQK
QVDNDIHSLIEHHVGKKQEFNQDTIIARMMIPMINEVIRCLDEGIIASPAEADIALVYGL
GFPPFRGGVFRYLDTIGLAQFVANAEQYSELGPLYQIPESLKQKALRNETYYPKPAKVDV
NIRELA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgctctatcaaagcgaaaatattcaagccgattgggtgaagcaaggtattgttgagctc
gttttcaatgctagcggttctattaataaattagatacaaaaacggtggcaatgttaagc
gaagcgttaacagtattagaaaacacatctgatctaaaaggggttattttacgttcagaa
aaacccgcctttattgttggtgccgatattaccgaatttttatcactttttgatgcaccg
gttgaagaactgacacaatggctacattttgctaatcatattttcaatcgattagaagat
ctccccgttcctacagtttctgccattaatggctacgccctaggcggtggctgtgaatgt
gtattagcaacggattttcgtattgcatcaccggatttacgcattggtttacccgaaaca
aaacttggtattatgccgggttttggtggctctgttcggctacctcgccttattggcgtt
gataatgccttagaaattattaccgcaggtaaagatattaatgccgaaacggcacttaag
aatggcttaattcaagctattgtccctgttgataagctaaaagaaagtgccatttcactg
atagagcaagccattgatggcaaatttgactggcaagctgctcgtcaacctaaaactgtg
gcgttaagattaacggaacttgaacataaaatgtcatttgctgtggcaaaaggcatggtg
atgaaagtcgcaggccctcattatccagccccaatgaccgccgttaatacgatagaaaaa
gccgcatttctagatagaaaagcggcacttgaattggaaacagaaaactttgtcaaactg
acccgcaccgatgttgccaaagcattagtgggtatcttccttaatgatcaatatgtgaaa
ggtattactaaaaaacgtcatgctagcttgccaaaacaagcggcagtattaggcgcgggg
atcatgggtggcggaattgcctatcaatctgcactaaaaggcattcctgttaccatgaaa
gatattaatgccaactcccttgaattgggtatgacagaagcactcagtctgttacaaaaa
cgtcaagaaaaaggacgtatgagtgccgttgatatggcaaaaaccctcgcttctattcat
cctaccctaaactatgccagtgtagctgatgcacaaattgtggtcgaagcggtggttgaa
aaccctaaagtaaaagcctctgtacttgctgaaaccgaagcgctccttgctgatcatgct
gtacttgcttcgaatacctcaacaatccccatttcgctacttgccaaatcactaacacgc
cctgaaaatttctgtggaatgcacttctttaaccccgttcaccgcatgcctttagttgag
atcattaaaggtgaaaaaaccagcgaagagacgattaatcgcattgtcagttatgctagc
aaaatgggtaaaacgccaatcattgttaatgactgcccggggttctttgtcaatcgcgtg
ctcttcccttatttcgccggattttctcttttattaagagatggtgctgattttattgct
gtagataaagtgatggaaaaagcctttggctggccaatgggtccggcttatttactggat
gttgtcggtatcgatacagcgaatcatgctcaagcagtgatggctcaaggtttcccagac
agaatgggcagtattgataaagatgttattgcgcttttatatcagcaacaacgctatggt
caaaaaaataatcatggtttctatgactacactattgataagcgtggtaaaaaacaaaag
caggtagataacgatattcacagccttattgaacatcatgtcggtaaaaaacaggaattt
aaccaagacactattattgctcgtatgatgatcccaatgatcaatgaagttattcgttgc
ttagatgaaggcattatcgcctcacctgcagaagccgatattgcattagtgtatggttta
ggcttccctcctttccgtggtggtgtcttccgttacctcgataccattggattagcacaa
tttgttgcaaatgcagagcaatactcagagttagggccactttaccaaattcctgagagc
ttaaaacaaaaagcattacgtaacgaaacctactatccaaagcctgcaaaagtagatgtt
aacatcagagaactcgcttaa

DBGET integrated database retrieval system