KEGG   Parvimonas micra: NW74_01390Help
Entry
NW74_01390        CDS       T03515                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pmic  Parvimonas micra
Pathway
pmic00010  Glycolysis / Gluconeogenesis
pmic00260  Glycine, serine and threonine metabolism
pmic00680  Methane metabolism
pmic01100  Metabolic pathways
pmic01110  Biosynthesis of secondary metabolites
pmic01120  Microbial metabolism in diverse environments
pmic01130  Biosynthesis of antibiotics
pmic01200  Carbon metabolism
pmic01230  Biosynthesis of amino acids
Module
pmic_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NW74_01390 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    NW74_01390 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NW74_01390 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmic04131]
    NW74_01390 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmic04147]
    NW74_01390 (gpmA)
Enzymes [BR:pmic01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NW74_01390 (gpmA)
Membrane trafficking [BR:pmic04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NW74_01390 (gpmA)
Exosome [BR:pmic04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NW74_01390 (gpmA)
  Exosomal proteins of melanoma cells
   NW74_01390 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 ER
Motif
Other DBs
NCBI-ProteinID: AIZ36098
UniProt: A0A0B4S015
LinkDB All DBs
Position
complement(315651..316394)
Genome map
AA seq 247 aa AA seqDB search
MKLVLIRHGESEWNKLNLFTGWTDVGLSEKGIIEANEAGFLLKENNFDFDVCYCSYLKRA
INTLNIVLERMDRQWLPVIKTWKLNERHYGALQGLNKAETAEKYGEEQVKLWRRSFDVPP
PALDKDDKRCPHNQAPYRNVDKSELPYNESLKDTIERVIPYYEEVIKKDMLDGKRVLITA
HGNSLRALVKYLDNLTDEEIISVNIPTGIPLVYEFDDNFKVTNKYYLGNQDEINAKINSV
ANQAKKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttttaataagacatggagaaagtgaatggaacaagttgaatttatttacc
ggttggactgatgtaggtctttcagaaaaaggaatcatcgaagcaaatgaagccggtttt
ttactaaaagaaaataatttcgattttgacgtatgttactgttcatacttaaaaagggca
ataaacactttaaatatcgttttagaaagaatggatagacagtggttacctgttataaaa
acttggaaattaaatgaaagacattatggagcactacaaggcttaaacaaagctgaaact
gctgaaaaatatggagaagaacaagtaaaactttggagaagatcttttgatgttccacct
cctgctcttgataaagacgataaaagatgtcctcataatcaagcaccttacagaaatgtt
gataaaagtgaattaccttataatgaaagcttaaaagataccattgaaagagttattcct
tactatgaagaagtcataaaaaaagatatgttggacgggaaaagagttctaataactgca
cacggaaactcacttagagcattggttaaatatttagataatttaacagatgaagaaatt
atttcagtaaatattcctacaggaattcctttagtttatgaatttgatgacaattttaaa
gttacaaataaatattacttaggaaatcaagatgaaataaatgcaaagataaattctgtt
gcaaatcaggcaaagaaaaagtaa

DBGET integrated database retrieval system