KEGG   Parvimonas micra: NW74_05170Help
Entry
NW74_05170        CDS       T03515                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmic  Parvimonas micra
Pathway
pmic00010  Glycolysis / Gluconeogenesis
pmic00020  Citrate cycle (TCA cycle)
pmic00620  Pyruvate metabolism
pmic01100  Metabolic pathways
pmic01110  Biosynthesis of secondary metabolites
pmic01120  Microbial metabolism in diverse environments
pmic01130  Biosynthesis of antibiotics
pmic01200  Carbon metabolism
Module
pmic_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NW74_05170
   00020 Citrate cycle (TCA cycle)
    NW74_05170
   00620 Pyruvate metabolism
    NW74_05170
Enzymes [BR:pmic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NW74_05170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CAT
Motif
Other DBs
NCBI-ProteinID: AIZ36765
UniProt: A0A0B4S1S1
LinkDB All DBs
Position
complement(1118770..1119807)
Genome map
AA seq 345 aa AA seqDB search
MSHIKLRATPAARFLSKQNNIDLSLLKGTGPKGRIQKEDVLNFKNFGIIKVSSLAKKIAE
VEDVDLKQITGTGVNGKILKEDVLEFLTNKDVISTEKAVEEQQIETQEVKKSYGEVEEVP
MSMMRRTVAKRMSESYFTAPVFVANIEVDMTEVKNLRANIMQQLIDETGYKLTITDIISL
ATVKSLMKHPYVNCSLSADGTKILLHKYVNLAMAVGLESGLLTPVVKNAEKMNLRELMIS
LKDLTKKAVEMKLESEELEDSTFTISNLGMFGIDSFAPIINQPNSAILGVSATVDKPVVL
NGEITVRPIMKLSITVDHRVVDGMEAAKFLNTLKNYLENPISILV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatataaaattaagagcaacacctgctgcaagatttttatctaagcaaaataat
atcgacttatcattgctaaaaggaacaggccctaagggaagaattcaaaaagaagatgtt
ttaaattttaaaaattttggaattattaaagtatcttcccttgcaaagaaaattgccgag
gttgaagatgtagatttaaaacaaataacaggaactggagttaatggtaagattttaaag
gaagatgttttagaatttctaacaaataaagatgtaatttctacagaaaaagcagttgaa
gaacaacaaatcgaaactcaagaagttaaaaaatcatatggtgaagttgaagaagttcca
atgtcaatgatgagaagaactgttgctaagagaatgagtgaaagttatttcacagctcca
gtttttgtagcaaatatagaagttgatatgactgaagttaaaaacttaagagctaatatt
atgcaacaattaattgatgaaacaggatataaacttactattacagatataatttcttta
gcaactgtgaagagtttaatgaaacatccatatgtaaattgtagtttatcagcagatgga
actaaaattttacttcataaatatgtaaatcttgctatggctgttggtcttgaaagtgga
ctcttaactccggttgttaaaaatgctgagaaaatgaatttaagagaacttatgatttca
ttaaaggacttaactaaaaaagctgttgaaatgaaattagagtcagaagaattagaagat
agtacatttactattagtaacttaggaatgtttggaattgattcttttgctcctattata
aatcaacctaatagtgctattttgggtgtaagtgcaactgttgataaaccggttgttctt
aatggagaaataactgtaagacctattatgaaattatcaattactgttgatcatagggtt
gttgatggaatggaagctgcgaagtttttaaatactttgaaaaattatttagaaaatcct
atttcaattttagtttag

DBGET integrated database retrieval system