KEGG   Parvimonas micra: NW74_07610Help
Entry
NW74_07610        CDS       T03515                                 

Definition
(GenBank) peptide ABC transporter ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
pmic  Parvimonas micra
Pathway
pmic02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pmic00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NW74_07610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmic02000]
    NW74_07610
Transporters [BR:pmic02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    NW74_07610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 RsgA_GTPase AAA_16 NB-ARC AAA_29 NACHT AAA_15 AAA_23 RNA_helicase PRK G-alpha
Motif
Other DBs
NCBI-ProteinID: AIZ37198
UniProt: A0A0B4S307
LinkDB All DBs
Position
complement(1614364..1615368)
Genome map
AA seq 334 aa AA seqDB search
MDQKELLLEIKDLHTSFRIRDEYFDAVDGVDMKLFSDEILAIVGESGCGKSTLATTIMGL
HNPNYTRSTGEIWFEGKNLVGLSEKEFNEIRGEGIGMIFQDPLSSLNPLQRIGKQIEEGL
IYHTKMNAEERKARVLELIEQVGIPNPPRVARQYPHELSGGMRQRVIIAIALACKPKIII
ADEPTTALDVTIQAQILDLLVEIQKEINAGIILITHDLGVVAQLADRVCVMYAGQIVEEA
PVLELFTNAKHPYTRSLLNSIPQMDADDEDLYVIQGMVPSLKNLPRQGCRFKARIPWISD
EEHEENPTMHEVEPGHFVRCTCYKNFHFDEKEGN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaaagaattacttttggaaattaaagatttacacacaagttttagaatccgt
gatgaatattttgacgcagtagatggcgttgatatgaaattattctctgatgaaatacta
gctatagtaggagaaagtggttgtggtaaatcgactttggctactactattatgggttta
cataatccgaattatactcgttcaacaggagaaatttggtttgaagggaaaaatttagta
ggtttgtcagaaaaagaatttaatgaaattagaggagaaggtattggaatgattttccaa
gatccgctttcatctttaaatcctttgcaaagaataggaaaacaaatcgaggaaggtttg
atttatcatacaaaaatgaatgctgaagaaagaaaagcaagagttttggaattgattgaa
caagttggtattcctaatcctcctcgtgttgcaagacaatatccacatgaattgtcaggt
ggtatgagacaaagagttatcattgcaattgctcttgcttgtaaacctaagattattata
gcggacgaaccgacaactgcactcgatgtaacaattcaagcacaaatcttagaccttttg
gttgaaattcaaaaggaaattaatgccggaattattttgattactcacgatttaggagtt
gttgctcagcttgcagacagagtttgtgtaatgtatgccggacaaatagttgaagaagca
cctgttttagagttatttacaaacgcaaaacatccttatactaggagtttgttaaacagt
attcctcaaatggatgcagatgatgaagatttgtacgttatacaaggtatggttccttca
cttaaaaacttaccaagacaaggttgtaggtttaaagccagaattccttggataagtgat
gaagaacatgaagaaaatcctacaatgcatgaagttgaacctggacatttcgtaagatgt
acttgttataagaattttcattttgatgaaaaggagggtaattaa

DBGET integrated database retrieval system