KEGG   Prochlorococcus marinus MIT 9211: P9211_04031
Entry
P9211_04031       CDS       T00616                                 

Gene name
odhB
Definition
(GenBank) Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00010  Glycolysis / Gluconeogenesis
pmj00020  Citrate cycle (TCA cycle)
pmj00620  Pyruvate metabolism
pmj01100  Metabolic pathways
pmj01110  Biosynthesis of secondary metabolites
pmj01120  Microbial metabolism in diverse environments
pmj01200  Carbon metabolism
Module
pmj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P9211_04031 (odhB)
   00020 Citrate cycle (TCA cycle)
    P9211_04031 (odhB)
   00620 Pyruvate metabolism
    P9211_04031 (odhB)
Enzymes [BR:pmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     P9211_04031 (odhB)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding TOBE_3
Other DBs
NCBI-ProteinID: ABX08334
CyanoBase: P9211_04031
UniProt: A9BE24
LinkDB
Position
378671..380041
AA seq 456 aa
MATHDIFMPALSSTMTEGKIVEWLKNPGEKVARGEAVLVVESDKADMEVESFQDGYLAAV
LMPAGSTAPVGEIIGLIVETEDQIAEVKAKNPTKDQASKEVSSSDSESSKQTLEVASQDQ
GSVLEVQASKKAESLPPRAVVNDGRIIATPRARKLASQLGVDLATVLGTGPHGRIQAEDV
QTAQGQPITVPWVAESDAPARLEVFNSQAANTGAPQEETKVNEAPKGNSFGAPGETVSFN
TLQQAVNRNMEASLSIPCFRVGYSINTDKLDIFYKQVKPNGVTMTALLAKAVGKTLARHP
QLNAACSNEGMSYPEQVNVAVAVAMEEGGLITPVLQNADTTDLFELSRQWADLVKRSRSK
QLQPNEYSSGTFTISNLGMFGVDRFDAILPPGTGAILAIAASIPQVVAAKDGSMAVKRQM
QVNLTADHRVIYGADGAAFLKDLSRLIENNPEQLAT
NT seq 1371 nt   +upstreamnt  +downstreamnt
ttggcaacacacgacatttttatgcccgctcttagttccactatgacggaggggaaaata
gttgaatggcttaagaatcccggcgaaaaagttgcccgaggagaggctgttcttgtagtg
gagtctgataaggctgacatggaagtcgagtcatttcaggatggatacctcgctgcagtg
cttatgccagcaggcagtacagccccggttggtgaaataattggtttgattgttgaaaca
gaagatcagattgctgaagtaaaagctaagaatccgacaaaagatcaggcctcaaaagaa
gtcagctcaagcgactctgaatcttctaagcagacacttgaagtagcctctcaagatcaa
ggatctgttttagaagttcaagcatcaaaaaaagctgaatctttgcctcctcgagccgtt
gtgaatgatggtcgtatcattgccacccctagagccagaaagcttgcctcgcaattaggc
gtagacttggcaactgtgcttgggacaggaccgcatggacgaattcaagctgaagatgtt
caaactgcccaaggacaaccaattactgtcccatgggtggcagaaagtgatgcaccagca
cgattagaggtcttcaactctcaagcagctaatacaggcgctcctcaagaagagactaag
gtgaatgaagctcccaagggtaatagttttggggcccctggggagacagtctcattcaat
actcttcagcaagcagtcaatagaaatatggaggcaagcttatctattccttgttttagg
gtgggttattcaataaatacagacaagcttgatattttttataagcaagtaaaacctaat
ggagtcactatgactgctttattggctaaagcagttgggaagacgcttgctcgacatcct
caattgaatgcagcgtgcagtaatgaaggcatgtcttatccagagcaagttaatgtagca
gttgcagttgcaatggaagaaggggggctaatcacaccggtacttcagaatgcagatact
acggatctatttgagttgtcacgtcaatgggcagatttagttaaacgttcaagatcaaaa
caacttcaacctaatgaatacagtagtggcacttttaccatttctaatttaggaatgttt
ggcgtagaccgttttgatgccatactcccacctgggactggtgcaatcttggcaattgct
gcttcaattcctcaggtcgtggcagctaaggatgggtcgatggctgtaaaacgccaaatg
caagtgaatcttactgccgatcaccgagttatttatggtgcggatggcgcagcatttttg
aaagacctttcaaggttgattgaaaacaaccctgaacaacttgctacttaa

DBGET integrated database retrieval system