KEGG   Prochlorococcus marinus MIT 9211: P9211_05451Help
Entry
P9211_05451       CDS       T00616                                 

Gene name
chlL
Definition
(GenBank) Protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00860  Porphyrin and chlorophyll metabolism
pmj01100  Metabolic pathways
pmj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P9211_05451 (chlL)
Enzymes [BR:pmj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     P9211_05451 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH AAA_31 CbiA ArsA_ATPase ParA AAA_24 SRP54 MeaB MipZ NB-ARC AAA_26 AAA_25 RNA_helicase PRK CBP_BcsQ AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: ABX08476
CyanoBase: P9211_05451
UniProt: A9BEG6
LinkDB All DBs
Structure
PDB: 

Position
complement(510394..511284)
Genome map
AA seq 296 aa AA seqDB search
MTTTLASRPDGEGSVQVKLDPKVNIEEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKKV
LQIGCDPKHDSTFTLTHKMVPTVIDILEEVDFHSEELRPEDFMFKGFNGVQCVESGGPPA
GTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFD
SIFAMNRIVAAINAKAKNYKVRLGGVIANRSADLDQIEKFNERTGLKTMAHFRNVDAIRR
SRLKKCTIFEMDPEEEGVKEVQNEYLSLAKKMIDNVEPLEVEPLKDREIFDLLGFD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgactacaactctagccagccgtccagatggcgaaggaagcgtacaagtaaagctagac
cctaaagtcaatatagaagagggggcactagtaattgctgtttatggcaaaggtggaatt
ggtaaatcaaccacatcatccaatctctctgccgcattctcaaaactagggaagaaagtc
cttcaaattggttgcgatccaaaacatgacagtacttttactcttactcataaaatggtc
cccacggtaattgacattcttgaagaagtcgatttccacagcgaagagctccgcccagaa
gactttatgttcaaaggatttaatggagtgcagtgtgtagaaagtggggggcctccagca
ggcactggttgcggaggctatgtaactggacaaacagtaaaactactaaaggaacaccat
ctacttgaagacactgatgttgttatttttgatgtacttggagatgtggtttgcggaggt
tttgccgctcctttacaacatgcgaactattgcttgatagttactgcaaatgattttgac
tcaatcttcgcaatgaatcgcatagttgcagcaataaatgccaaagctaaaaattataaa
gttcgccttggtggagtgatcgcaaatcgttctgcagatttagatcagatagaaaagttc
aatgaaagaacaggtctcaaaactatggctcattttagaaatgtagacgcaatacgccgt
tcaagacttaaaaaatgcacaattttcgagatggatccagaagaagaaggtgtaaaagaa
gtccaaaacgaatatctttctcttgcgaaaaaaatgatcgataatgtcgaaccattagaa
gtagaacccttaaaggatcgcgaaatatttgacttactaggctttgattaa

DBGET integrated database retrieval system