KEGG   Pseudomonas mendocina NK-01: MDS_0492Help
Entry
MDS_0492          CDS       T01473                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00030  Pentose phosphate pathway
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01120  Microbial metabolism in diverse environments
pmk01130  Biosynthesis of antibiotics
pmk01200  Carbon metabolism
pmk01230  Biosynthesis of amino acids
Module
pmk_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MDS_0492
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    MDS_0492
Enzymes [BR:pmk01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     MDS_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C DUF2564
Motif
Other DBs
NCBI-ProteinID: AEB56523
LinkDB All DBs
Position
527736..529736
Genome map
AA seq 666 aa AA seqDB search
MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYLKHNPQNPNFADRDRF
VLSNGHGSMLIYSLLHLTGYDLSIDDLKNFRQLHSKTPGHPEYGYTPGVETTTGPLGQGI
ANAVGFAIAEKVLGAQFNREGHDIVDHNTYVFLGDGCMMEGISHEVCSLAGTLGLGKLIA
FYDDNGISIDGEVEGWFTDDTPKRFEAYGWQVIRNVDGHDAEEIKMAIETARKSVGQPTL
ICCKTTIGFGSPNKQGKEECHGAPLGNDEIALTRAALGWNHGPFEIPADIYAEWDAKAAG
AAAEAAWNEKFAAYAAAFPELAAEFKRRIAGELPADFAEKAAAYVREVAEKGETIASRKA
SQNALNAFGPLLPEFLGGSADLAGSNLTLWKGCKGVSADDASGNYMFYGVREFGMSAIMN
GIALHGGFVPYGATFLIFMEYARNAVRMSALMKKRVLYVFTHDSIGLGEDGPTHQPIEQL
ASLRGTPNLDTWRPADAVESAVAWKHAIERADGPSALVFSRQNLPHQPRDAQQLADVARG
GYVLKDSAGEPELILIATGSEVGLAVAAYDKLTAAGRKVRVVSMPSTSVFDQQDAAYKQA
VLPLEVGARIAIEAAHADFWYKYVGLEGRIIGMTTFGESAPAAALFEEFGFTVDNVVGTA
EELLDA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgcccagccgtcgtgagcgagccaatgccattcgtgccctcagcatggatgctgtgcag
aaagccaacagcggccaccccggtgcccccatgggtatggcggacatcgccgaagtgctg
tggcgcgattacctgaagcacaacccgcagaacccgaacttcgctgatcgtgaccgcttc
gtgctgtccaacggtcacggttcgatgctgatctattcgctgctgcacctgaccggctat
gacctgtcgatcgacgacctgaagaacttccgtcaactgcacagcaagaccccgggccac
ccggagtacggctacaccccgggcgtggaaaccaccaccggcccgctcggccagggcatc
gccaacgccgtcggtttcgccattgccgagaaggtactgggcgcgcagttcaaccgtgaa
ggccacgatatcgtcgaccacaacacctacgtgttcctcggcgacggctgcatgatggaa
ggcatcagccatgaagtctgctcgctggctggtaccctcggcctgggcaagctgatcgcc
ttctacgacgacaacggcatctccatcgacggcgaagtcgaaggctggttcaccgacgat
acgccgaagcgtttcgaagcctatggttggcaggtgatccgcaatgtcgacggccatgat
gccgaagagatcaagatggccatcgagaccgcgcgcaagagcgtgggccagccgactctg
atctgctgcaagaccaccatcggtttcggctcgccgaacaagcagggcaaggaagagtgc
cacggcgcgccgctgggcaacgacgagatcgccctgacccgtgctgccctgggctggaac
catggtcctttcgagattcctgctgacatctacgccgagtgggacgccaaggccgccggt
gccgctgccgaagccgcctggaacgaaaaattcgccgcctacgcggctgcgttccccgag
ctggctgccgagttcaagcgccgcatcgctggcgagctgccggccgacttcgccgagaag
gccgctgcctacgtgcgtgaagtggcggagaagggtgaaaccatcgccagtcgcaaggct
agccagaatgcgctgaacgccttcggcccgctgctgccggagttcctcggtggctccgcc
gacctggccggttccaacctgaccctgtggaaaggctgcaagggcgtttctgccgacgac
gcatccggcaactacatgttctacggcgtgcgcgagttcggcatgagcgcgatcatgaac
ggtatcgccctgcatggcggtttcgtaccgtacggtgcgaccttcctaatcttcatggaa
tacgcgcgcaacgccgtgcgcatgtccgcactgatgaaaaagcgcgtcctgtacgtgttc
acccacgattccatcggcctcggggaggacggcccgacccaccagccgatcgagcaactg
gccagcctgcgtggcacgccgaacctcgacacctggcgtccggcagatgcggtggaatcc
gctgtggcctggaagcacgccatcgagcgcgccgatggcccgagcgctctggtgttcagc
cgtcagaacctgccgcaccagccgcgtgatgcccagcaactggccgatgtcgcccgtggt
ggttacgtgctcaaggacagcgccggtgagccggaactgatcctcattgccaccggctcg
gaagtcggcctggccgtggctgcctacgacaagctgaccgcagccggccgtaaggtgcgc
gtggtgtcgatgccgtcgaccagcgtgttcgaccagcaggacgccgcttacaaacaggcc
gtgttgccgttggaagtgggcgcgcgtatcgccatcgaagccgcgcatgccgacttctgg
tacaagtacgtcggcctggaagggcgcatcatcggcatgactaccttcggtgagtcggcc
ccggcggctgcgctgttcgaagaattcggcttcactgtcgacaacgtcgtcggcaccgcc
gaagaactgctggacgcctga

DBGET integrated database retrieval system