KEGG   Pseudomonas mendocina NK-01: MDS_0579Help
Entry
MDS_0579          CDS       T01473                                 

Definition
(GenBank) 1A family penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00550  Peptidoglycan biosynthesis
pmk01100  Metabolic pathways
pmk01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MDS_0579
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    MDS_0579
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pmk01003]
    MDS_0579
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmk01011]
    MDS_0579
Enzymes [BR:pmk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     MDS_0579
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MDS_0579
Glycosyltransferases [BR:pmk01003]
 Polysaccharide
  Bacterial polysaccharide
   MDS_0579
Peptidoglycan biosynthesis and degradation proteins [BR:pmk01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   MDS_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AEB56610
LinkDB All DBs
Position
complement(620697..623108)
Genome map
AA seq 803 aa AA seqDB search
MIRLLKFIWWSCVAVFCGLLLSFSGAFLYLSPTLPSVESLRQVQLQIPLRVYSSDAKLIA
EFGEMRRSPIRFDEIPKEFISALLAAEDDNFANHYGVDVTSLMRAATQLLKSGQIQSGGS
TITMQVAKNFFLTSERSFSRKATEILLALQIERELSKDEILELYVNKIYLGHRAYGIEAA
AQVYYGKSIRDLNLAQMAMIAGLPKAPSRYNPLVNPTRAKERRDWILGRLYRLGRIDQAS
YEQALAEEVDARYHVPAPELSAPYIAEMARAEMVGRYGSEAYTEGFNVTTTVPSHLQEVA
NTALRDGLIAYDQRHGYRGPESRLPGMTRDTWLTELGKFRSIGGLEPAVVTQVEKSGILV
LTRNGEEQAVAWDSMKWARPFLNTNSLGPRPQQPGDVAQVGDIVRVQRQEDGSLRFTQVP
AAQSALVSLDPYSGAIQALVGGFSFDQSNYNRAVQAKRQPGSSFKPFIYSAALDSGYTAA
TLVNDAPIILSDDYLSQKWRPKNDNNTFLGPIRMREALYKSRNLVSIRLLQDMGIDRSLR
YIERFGFAPQDLPRNLSLALGTASLTPMEIAEGWATFANGGYKIEPYLIERIDDRNGKPL
FRANPARVPGSQPTEENANLTVNAADDLPLEEPKVAEQIIDERTAYIMTSMLQDVIKRGT
GRRALALGRNDLAGKTGTTNESKDSWFSGYNADYVTTVWAGFDQPESLGRHEYGGTVALP
IWMNYMGPILKDRPSHLPKEPKGLLTLRVDPLSGRAAAPGTPDAYFELFKSEDSPPPMSE
FEPGMGVPGSPLPADEMAPIDLF
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
ttgatacgcctgctgaagttcatctggtggtcttgcgttgccgttttttgtgggctgttg
ctcagtttcagcggtgcgtttctttatcttagcccgacccttccgtccgtcgagtcgctg
cgccaggtccagctacagattcccctgcgcgtctacagcagcgatgccaagctgatcgcc
gagttcggcgagatgcgccgctcgcctattcgcttcgacgaaatccccaaagaattcatc
agcgccctgctggcagcagaagacgataatttcgccaatcattatggcgtcgatgtgacc
agcctgatgcgcgctgccacgcaattattgaaaagcggtcagattcaaagcggtggcagc
accattaccatgcaggtggcgaagaacttcttcctcaccagcgagcgcagcttctcgcgc
aaggccaccgaaatcctcctggccctgcagatcgagcgcgagctgagtaaggacgaaatc
ctcgaactgtacgtcaacaagatctatctcggtcatcgcgcctatggcatcgaggccgca
gcccaggtctactacggcaagtcgatccgtgacctgaacctggcacagatggcgatgatt
gccggcttgccgaaagctccctcgcgctacaacccactggtcaacccgactcgcgccaag
gagcgccgcgactggattctgggccgcctgtatcgccttggccgcatcgaccaagccagt
tacgagcaagcgctggccgaagaagtcgatgcacgctaccacgtgcccgcccccgaactg
agcgcgccttatatagcggagatggcacgtgcggaaatggtcggtcgctatggcagcgag
gcctatacagaaggcttcaacgtcaccaccaccgtccccagccacctgcaggaagtggcc
aacactgcgctgcgtgacggactgatcgcctacgatcagcgccatggctaccgcggcccc
gagagccgcctgccaggcatgacacgtgacacctggctcaccgaactgggcaagttccgc
agcatcggcggcctggagcctgccgtggtgacccaggtcgagaagagcggcatcctggtg
ctgacccgcaatggcgaagaacaggctgtggcctgggacagcatgaagtgggcgcgcccc
ttccttaataccaacagccttggcccacgcccgcagcaacccggcgatgtcgcccaggtc
ggcgatatcgtccgtgtgcagcgccaggaagatggcagcctgcgctttacgcaggtaccg
gcggcgcaaagtgcgctggtttccctcgatccctacagcggcgccattcaggcactggtc
ggcggtttctctttcgaccagagcaactacaaccgtgccgtacaggccaagcgccagccg
ggctccagcttcaaacctttcatctacagcgcggcactggatagcggctataccgcggca
acgctggtcaacgatgcgccgatcatcctctccgacgactacctgtcgcagaagtggcga
ccgaagaacgacaacaacaccttcctcggcccgatccgcatgcgcgaggcgctgtacaag
tcgcgcaacctggtctcgatccgcctgctgcaggatatgggcatcgaccgcagcctgcgc
tacatcgaacgcttcggtttcgccccacaggacctgccacgcaacctgtcactggccctc
ggtaccgccagcctcacgccaatggaaattgccgaaggctgggcgaccttcgccaacggc
ggctacaagatcgagccttacctgatcgaacgcatcgatgatcgcaacggcaagccgttg
ttccgcgccaacccggcgcgcgtcccaggcagccagccgaccgaggagaatgccaacctg
acggttaacgccgccgacgatctgcccctggaggaacccaaggtagccgagcagatcatc
gacgagcgcacggcctacatcatgaccagcatgctgcaggacgtgatcaagcgcggaact
ggtcgccgcgccctggcactgggccgtaacgacctggcgggcaagaccggcaccaccaac
gagtccaaggacagctggttctccggctacaacgccgactacgtcaccactgtctgggcc
ggcttcgaccagccggaaagcttgggccgacatgagtacggcggcactgtggcgctgcct
atctggatgaactacatgggccccatcctcaaggatcgcccgagccatctacccaaggaa
cccaagggcctgctgaccctgcgcgttgacccgttgagcggacgcgccgccgcacccggc
acgccagacgcgtacttcgagctattcaagagcgaggactcaccgccgccgatgagcgag
ttcgaacccggtatgggtgttcctggcagcccgctgccggctgatgagatggcgccgatc
gatctgttctag

DBGET integrated database retrieval system