KEGG   Pseudomonas mendocina NK-01: MDS_0584Help
Entry
MDS_0584          CDS       T01473                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
pmk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmk01100  Metabolic pathways
pmk01110  Biosynthesis of secondary metabolites
pmk01130  Biosynthesis of antibiotics
pmk01230  Biosynthesis of amino acids
Module
pmk_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MDS_0584
Enzymes [BR:pmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     MDS_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AbiEi_2 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: AEB56615
LinkDB All DBs
Position
628275..628766
Genome map
AA seq 163 aa AA seqDB search
MGAGKSTIGRLLAKELRLPFKDSDKEIEQRTGADIPWIFDVEGEQGFREREQAVIAELSM
QDGLVLATGGGAVMRPENRQALHAGGRVVYLHTSVEQQIDRTSRDRNRPLLRTANPAQVL
RDLMAMRDPLYREVADIVIETDERPPRMVVQEILSRLEALSPR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctggaaagagcaccatcgggcgtttgcttgccaaagagctgcgtttgcctttc
aaggactccgacaaggagatcgagcagcgtaccggcgccgatattccctggatcttcgat
gtcgagggagagcagggctttcgtgagcgagagcaggcggtgatcgctgagctgtcgatg
caggacggtcttgtattggccactggtggtggagccgtcatgcgtccggagaaccgtcag
gctctgcatgctggtgggcgagtcgtttacctgcacacctccgtggagcagcagatcgac
cggacctcgcgtgatcgtaatcgcccgctgttgcgcacggccaatccggctcaggtgctc
agggatctaatggcgatgcgtgatcctctctaccgagaggtggccgatatcgtcatagag
acggacgagcgtccgccgcgtatggtggttcaggaaattctctcgcgtctggaagccttg
tcgccccgttaa

DBGET integrated database retrieval system